KLHDC4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• KLHDC4 Polyclonal antibody (16915-1-AP)

• Featured Product
• KD/KO Validated

KLHDC4 Polyclonal Antibody for WB, ELISA

Cat No. 16915-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

kelch domain containing 4, Kelch domain-containing protein 4

• 

  WB analysis of mouse thymus using 16915-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 16915-1-AP (KLHDC4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human stomach using 16915-1-AP

  human stomach tissue were subjected to SDS PAGE followed by western blot with 16915-1-AP (KLHDC4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for KLHDC4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse thymus tissue, human stomach tissue, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16915-1-AP targets KLHDC4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10096

  Product name: Recombinant human KLHDC4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 171-489 aa of BC011680

  Sequence: YIYYNDVYAFNLDTFTWSKLSPSGTGPTPRSGCQMSVTPQGGIVVYGGYSKQRVKKDVDKGTRHSDMFLLKPEDGREDKWVWTRMNPSGVKPTPRSGFSVAMAPNHQTLFFGGVCDEEEEESLSGEFFNDLYFYDATRNRWFEGQLKGPKSEKKKRRRGRKEEPEGGSRPACGGAGTQGPVQLVKEVVAEDGTVVTIKQVLTAPGSAGQPRSEDEDSLEEAGSPAPGPCPRSNAMLAVKHGVLYVYGGMFEAGDRQVTLSDLHCLDLHRMEAWKALVEMDPETQEWLEETDSEEDSEEVEGAEGGVDDEDSGEESGAED

• Full Name: kelch domain containing 4
• Calculated Molecular Weight: 520aa,58 kDa; 489aa,55 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC011680
• Gene Symbol: KLHDC4
• Gene ID (NCBI): 54758
• RRID: AB_2280773
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TBB5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The KLHDC4 Polyclonal antibody (Cat# 16915-1-AP) has 2 citations. These appear in Scientific Reports and Cancers (Basel). The research fields include clear cell renal cell carcinoma, where KLHDC4 was identified as a prognostic biomarker driving tumor progression via PI3K/AKT signaling, and colorectal cancer, where it was studied in the context of p53 tumor suppression modulation. Both studies utilized WB and IHC applications in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Sci Rep; KLHDC4 serves as a novel prognostic biomarker and drives tumor progression via PI3K/AKT signaling in clear cell renal cell carcinoma.; Authors - Qingjiang Xu ; KD Validated
human	WB	Cancers (Basel); Long Noncoding RNA RP11-278A23.1, a Potential Modulator of p53 Tumor Suppression, Contributes to Colorectal Cancer Progression; Authors - Masayo Kamikokura ; KD Validated