KLHDC4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KLHDC4 Polyclonal antibody, PBS Only (16915-1-PBS)

• 

  WB analysis of mouse thymus using 16915-1-AP (same clone as 16915-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 16915-1-AP (KLHDC4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16915-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human stomach using 16915-1-AP (same clone as 16915-1-PBS)

  human stomach tissue were subjected to SDS PAGE followed by western blot with 16915-1-AP (KLHDC4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16915-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 16915-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16915-1-AP (KLHDC4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• KD/KO Validated

KLHDC4 Polyclonal Antibody for WB, ELISA

Cat No. 16915-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

---

Product Information

16915-1-PBS targets KLHDC4 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10096

  Product name: Recombinant human KLHDC4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 171-489 aa of BC011680

  Sequence: YIYYNDVYAFNLDTFTWSKLSPSGTGPTPRSGCQMSVTPQGGIVVYGGYSKQRVKKDVDKGTRHSDMFLLKPEDGREDKWVWTRMNPSGVKPTPRSGFSVAMAPNHQTLFFGGVCDEEEEESLSGEFFNDLYFYDATRNRWFEGQLKGPKSEKKKRRRGRKEEPEGGSRPACGGAGTQGPVQLVKEVVAEDGTVVTIKQVLTAPGSAGQPRSEDEDSLEEAGSPAPGPCPRSNAMLAVKHGVLYVYGGMFEAGDRQVTLSDLHCLDLHRMEAWKALVEMDPETQEWLEETDSEEDSEEVEGAEGGVDDEDSGEESGAED

• Full Name: kelch domain containing 4
• Calculated Molecular Weight: 520aa,58 kDa; 489aa,55 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC011680
• Gene Symbol: KLHDC4
• Gene ID (NCBI): 54758
• RRID: AB_2280773
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TBB5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.