KLHL13 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KLHL13 Polyclonal antibody, PBS Only (15612-1-PBS)

• 

  WB analysis of Jurkat using 15612-1-AP (same clone as 15612-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 15612-1-AP (KLHL13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15612-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15612-1-AP (same clone as 15612-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15612-1-AP (KLHL13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15612-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 15612-1-AP (same clone as 15612-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 15612-1-AP (KLHL13 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15612-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 15612-1-AP (same clone as 15612-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 15612-1-AP (KLHL13 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15612-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 15612-1-AP (same clone as 15612-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 15612-1-AP (KLHL13 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15612-1-PBS in a different storage buffer formulation.

KLHL13 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15612-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15612-1-PBS targets KLHL13 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8003

  Product name: Recombinant human KLHL13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 487-655 aa of BC008729

  Sequence: GGVMYISGGITHDTFQKELMCFDPDTDKWIQKAPMTTVRGLHCMCTVGERLYVIGGNHFRGTSDYDDVLSCEYYSPILDQWTPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPDKDEWHKVFDLPESLGGIRACTLTVFPPEETTPSPSRESPLSAP

• Full Name: kelch-like 13 (Drosophila)
• Calculated Molecular Weight: 74 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC008729
• Gene Symbol: KLHL13
• Gene ID (NCBI): 90293
• RRID: AB_2130739
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P2N7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.