KLHL15 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KLHL15 Polyclonal antibody, PBS Only (25066-1-PBS)

• 

  WB analysis of HeLa using 25066-1-AP (same clone as 25066-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 25066-1-AP (KLHL15 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25066-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 25066-1-AP (same clone as 25066-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25066-1-AP (KLHL15 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25066-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 25066-1-AP (same clone as 25066-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25066-1-AP (KLHL15 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25066-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 25066-1-AP (same clone as 25066-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25066-1-AP (KLHL15 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25066-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 25066-1-AP (same clone as 25066-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25066-1-AP (KLHL15 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25066-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 25066-1-AP (same clone as 25066-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25066-1-AP (KLHL15 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25066-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 25066-1-AP (same clone as 25066-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25066-1-AP (KLHL15 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25066-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 25066-1-AP (same clone as 25066-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25066-1-AP (KLHL15 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25066-1-PBS in a different storage buffer formulation.

KLHL15 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25066-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

25066-1-PBS targets KLHL15 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16878

  Product name: Recombinant human KLHL15 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC109058

  Sequence: MAGDVEGFCSSIHDTSVSAGFRALYEEGLLLDVTLVIEDHQFQAHKALLATQSDYFRIMFTADMRERDQDKIHLKGLTATGFSHVLQFMYYGTIELSMNTVHEILQAAMYVQLIEVVKFCCSFLLAKICLENCAEIMRLLDDFGVNIEGVREKLDTFLLDNFVPLMSRPDFLSYLSFEKLMSYLDNDHLSRFPEIELYEAVQSWLRHDRRRWRHTDTIIQNIRFCLMTPTSVFEKVKTSEFYRYSRQLRYEVDQALNYFQNVHQQPLLDMKSSRIRSAKPQTTVFRGMIGHSMVNSKILLLKKPRVWWELEGPQVPLRPDCLAIVNNFVFLLGGEELGPDGEFHASSKVF

• Full Name: kelch-like 15 (Drosophila)
• Calculated Molecular Weight: 604 aa, 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC109058
• Gene Symbol: KLHL15
• Gene ID (NCBI): 80311
• RRID: AB_2879880
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96M94
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.