KLHL18 Polyclonal antibody

• 

  WB analysis of HepG2 using 17229-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 17229-1-AP (KLHL18 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 17229-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17229-1-AP (KLHL18 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 17229-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17229-1-AP (KLHL18 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 17229-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 17229-1-AP (KLHL18 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 17229-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17229-1-AP (KLHL18 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 17229-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 17229-1-AP (KLHL18 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 17229-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon using 17229-1-AP (KLHL18 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human colon using 17229-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon using 17229-1-AP (KLHL18 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human brain using 17229-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 17229-1-AP (KLHL18 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human brain using 17229-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 17229-1-AP (KLHL18 antibody) at dilution of 1:100 (under 40x lens).

• Featured Product
• KD/KO Validated

KLHL18 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17229-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

OK/SW-cl.74, Kelch-like protein 18

---

Tested Applications

• Positive WB detected in: HepG2 cells, COLO 320 cells, HEK-293 cells, HeLa cells, HL-60 cells, mouse brain tissue
• Positive IHC detected in: human colon tissue, human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

17229-1-AP targets KLHL18 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11070

  Product name: Recombinant human KLHL18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 198-509 aa of BC032620

  Sequence: YHLMPERRPHLPAFRTRPRCCTSIAGLIYAVGGLNSAGDSLNVVEVFDPIANCWERCRPMTTARSRVGVAVVNGLLYAIGGYDGQLRLSTVEAYNPETDTWTRVGSMNSKRSAMGTVVLDGQIYVCGGYDGNSSLSSVETYSPETDKWTVVTSMSSNRSAAGVTVFEGRIYVSGGHDGLQIFSSVEHYNHHTATWHPAAGMLNKRCRHGAASLGSKMFVCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCGRLYAVGGYDGQSNLSSVEMYDPETDCWTFMAPMACHEGGVGVGCIPLLTI

• Full Name: kelch-like 18 (Drosophila)
• Calculated Molecular Weight: 509 aa, 56 kDa
• Observed Molecular Weight: 63 kDa, 56 kDa
• GenBank Accession Number: BC032620
• Gene Symbol: KLHL18
• Gene ID (NCBI): 23276
• RRID: AB_10665554
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94889
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Cell Biosci; KLHL18 inhibits the proliferation, migration, and invasion of non-small cell lung cancer by inhibiting PI3K/PD-L1 axis activity.; Authors - Xizi Jiang
human	WB	Biol Open; The CUL3-KLHL18 ligase regulates mitotic entry and ubiquitylates Aurora-A.; Authors - Moghe Saili S ; KD Validated