KLHL2 Polyclonal antibody

• 

  WB analysis of MCF-7 using 14449-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 14449-1-AP (KLHL2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14449-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14449-1-AP (KLHL2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 14449-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 14449-1-AP (KLHL2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of MCF-7 using 14449-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using KLHL2 antibody (14449-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

KLHL2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 14449-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Kelch-like protein 2, Actin-binding protein Mayven, ABP KELCH

---

Tested Applications

• Positive WB detected in: K-562 cells, human brain tissue, MCF-7 cells, SH-SY5Y cells
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14449-1-AP targets KLHL2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5950

  Product name: Recombinant human KLHL2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 273-593 aa of BC022503

  Sequence: DYLIEAMKYHLLPTEQRILMKSVRTRLRTPMNLPKLMVVVGGQAPKAIRSVECYDFKEERWHQVAELPSRRCRAGMVYMAGLVFAVGGFNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDGSTGLSSVEAYNIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDVASRQCLSTVECYNATTNEWTYIAEMSTRRSGAGVGVLNNLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVADMNMCRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPTTDKWTVVSSCMSTGRSYAGVTVIDKRL

• Full Name: kelch-like 2, Mayven (Drosophila)
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC022503
• Gene Symbol: KLHL2
• Gene ID (NCBI): 11275
• RRID: AB_2234221
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95198
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KLHL2 contains an SH3-binding domain in the N terminus and a POZ domain and 6 tandem repeats of approximately 50 amino acids each in the C terminus. In astrocytoma/glioblastoma cells, KLHL2 colocalized with actin filaments in the cytoskeleton remodeling regions in stress fibers and in patchy cortical actin-rich regions of the cell margins. In primary rat hippocampal neurons, it was highly expressed in the cell body and in neurite processes(PMID: 10397770).