KLHL28 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KLHL28 Polyclonal antibody, PBS Only (25224-1-PBS)

• 

  WB analysis of Jurkat using 25224-1-AP (same clone as 25224-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25224-1-AP (KLHL28 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25224-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 25224-1-AP (same clone as 25224-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25224-1-AP (KLHL28 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25224-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 25224-1-AP (same clone as 25224-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 25224-1-AP (KLHL28 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25224-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 25224-1-AP (same clone as 25224-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 25224-1-AP (KLHL28 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25224-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 25224-1-AP (same clone as 25224-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 25224-1-AP (KLHL28 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25224-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 25224-1-AP (same clone as 25224-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 25224-1-AP (KLHL28 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25224-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 25224-1-AP (same clone as 25224-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 25224-1-AP (KLHL28 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25224-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 25224-1-AP (same clone as 25224-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 25224-1-AP (KLHL28 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25224-1-PBS in a different storage buffer formulation.

KLHL28 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25224-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

BTB/POZ domain-containing protein 5, BTBD5, Kelch-like protein 28

---

Product Information

25224-1-PBS targets KLHL28 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18665

  Product name: Recombinant human KLHL28 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 222-571 aa of BC121009

  Sequence: NSVRLPLLSVKFLTRLYEANHLIRDDRTCKHLLNEALKYHFMPEHRLSHQTVLMTRPRCAPKVLCAVGGKSGLFACLDSVEMYFPQNDSWIGLAPLNIPRYEFGICVLDQKVYVIGGIATNVRPGVTIRKHENSVECWNPDTNTWTSLERMNESRSTLGVVVLAGELYALGGYDGQSYLQSVEKYIPKIRKWQPVAPMTTTRSCFAAAVLDGMIYAIGGYGPAHMNSVERYDPSKDSWEMVASMADKRIHFGVGVMLGFIFVVGGHNGVSHLSSIERYDPHQNQWTVCRPMKEPRTGVGAAVIDNYLYVVGGHSGSSYLNTVQKYDPISDTWLDSAGMIYCRCNFGLTAL

• Full Name: kelch-like 28 (Drosophila)
• Calculated Molecular Weight: 571 aa, 64 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC121009
• Gene Symbol: KLHL28
• Gene ID (NCBI): 54813
• RRID: AB_2879972
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NXS3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KLHL28 also named as BTBD5 or Kelch like protein 28 is a 571 amino acid protein, which contains one BTB domain and six kelch repeats. KLHL28 localizes in the cytoplasm and belongs to BTB/kelch-associated proteins family. KLHL28 may play a role in organizing the actin cytoskeleton of the brain cells. KLHL28 is expressed as two isoforms produced by alternative splicing.