KLHL31 Polyclonal antibody

• 

  WB analysis using 24781-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24781-1-AP (KLHL31 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse embryo using 24781-1-AP

  mouse embryo tissue were subjected to SDS PAGE followed by western blot with 24781-1-AP (KLHL31 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 24781-1-AP

  WB result of KLHL31 antibody (24781-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-KLHL31 transfected Jurkat cells.

• 

  IHC staining of mouse skeletal muscle using 24781-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 24781-1-AP (KLHL31 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 24781-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 24781-1-AP (KLHL31 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 24781-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 24781-1-AP (KLHL31 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human colon cancer using 24781-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 24781-1-AP (KLHL31 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HepG2 using 24781-1-AP

  Immunofluorescent analysis of HepG2 cells using 24781-1-AP (KLHL31 antibody) at dilution of 1:50 and Rhodamine-Goat anti-Rabbit IgG.

• Featured Product
• KD/KO Validated

KLHL31 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 24781-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

BKLHD6, KBTBD1, kelch like 31 (Drosophila), Kelch like protein 31, Kelch like protein KLHL, KLHL, KLHL31

---

Tested Applications

• Positive WB detected in: mouse embryo tissue, Jurkat cells
• Positive IHC detected in: mouse skeletal muscle tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24781-1-AP targets KLHL31 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20462

  Product name: Recombinant human KLHL31 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC137267

  Sequence: MAPKKKIVKKNKGDINEMTIIVEDSPLNKLNALNGLLEGGNGLSCISSELTDASYGPNLLEGLSKMRQENFLCDLVIGTKTKSFDVHKSVMASCSEYFYNILKKDPSIQRVDLNDISPLGLATVIAYAYTGKLTLSLYTIGSIISAAVYLQIHTLIKMCSDFLIREMSVENCMYVVNIAETYSLKNAKAAAQKFIRDNFLEFAESDQFMKLTFEQINELLIDDDLQLPSEIVAFQIAMKWLEFDQKRVKYAADLLSNIRFGTISAQDLVNYVQSVPRMMQDADCHRLLVDAMNYHLLPYHQNTLQSRRTRIRGGCRVLVTVGGRPGLTEKSLSRDILYRDPENGWSKLTE

• Full Name: kelch-like 31 (Drosophila)
• Calculated Molecular Weight: 634 aa, 70 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC137267
• Gene Symbol: KLHL31
• Gene ID (NCBI): 401265
• RRID: AB_2879718
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H511
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KLHL31 also named as BKLHD6, KBTBD1,or Kelch like protein 31 is a 634 amino acid protein, which contains one 1 BACK domain, one BTB domain and six Kelch repeats. KLHL31 as a transcription repressor in MAPK/JNK signaling pathway to regulate cellular functions. KLHL31 is strongly expressed in skeletal muscle and weakly in heart.