KLHL32 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KLHL32 Polyclonal antibody, PBS Only (28621-1-PBS)

• 

  WB analysis using 28621-1-AP (same clone as 28621-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28621-1-AP (KLHL32 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28621-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 28621-1-AP (same clone as 28621-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28621-1-AP (KLHL32 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28621-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 28621-1-AP (same clone as 28621-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using KLHL32 antibody (28621-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CL488-Phalloidin (red). This data was developed using the same antibody clone with 28621-1-PBS in a different storage buffer formulation.

KLHL32 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 28621-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

BKLHD5, BTB and kelch domain-containing protein 5, Kelch like protein 32, Kelch-like protein 32, KIAA1900

---

Product Information

28621-1-PBS targets KLHL32 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29003

  Product name: Recombinant human KLHL32 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 169-318 aa of BC071627

  Sequence: KHLSELLKSRPEEVLTLPYCLLQEVLKSDRLTSLSEEQIWQLAVRWLEHNCHYQYMDELLQYIRFGLMDVDTLHTVALSHPLVQASETATALVNEALEYHQSIYAQPVWQTRRTKPRFQSDTLYIIGGKKREVCKVKELRYFNPVDQENA

• Full Name: kelch-like 32 (Drosophila)
• Calculated Molecular Weight: 470 aa, 53 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC071627
• Gene Symbol: KLHL32
• Gene ID (NCBI): 114792
• RRID: AB_3742296
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96NJ5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KLHL32 (Kelch-like protein 32), also known BKLHD5, which is located in the cytoplasm. The expression level is high in the central nervous system, especially in astrocytes. In addition, it is also expressed in the motor cilia of fallopian tube. But the overall expression abundance is low. KLHL32 is mainly involved in the intracellular ubiquitination process. Ubiquitin is an important cellular regulatory mechanism, through which protein can be labeled to degrade or change its function. KLHL32 interacts with other protein through its BTB domain and Kelch repeat domain to help regulate this process. It is also a prognostic marker in glioblastoma and renal clear cell carcinoma. The molecular weight of KLHL32 is 70 kDa.