Use Able AI chat for product recommendations

KLHL7 Polyclonal antibody

KLHL7 Polyclonal Antibody for WB, ELISA

Cat No. 32697-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Kelch-like protein 7

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, mouse cerebellum tissue, mouse testis tissue, rat brain tissue, rat cerebellum tissue, HeLa cells, HepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

32697-1-AP targets KLHL7 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag38050

Product name: Recombinant human KLHL7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 291-586 aa of BC039585

Sequence: HDYRIALFGGSQPQSCRYFNPKDYSWTDIRCPFEKRRDAACVFWDNVVYILGGSQLFPIKRMDCYNVVKDSWYSKLGPPTPRDSLAACAAEGKIYTSGGSEVGNSALYLFECYDTRTESWHTKPSMLTQRCSHGMVEANGLIYVCGGSLGNNVSGRVLNSCEVYDPATETWTELCPMIEARKNHGLVFVKDKIFAVGGQNGLGGLDNVEYYDIKLNEWKMVSPMPWKGVTVKCAAVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVVDTCGANEETLET

Predict reactive species
Full Name kelch-like 7 (Drosophila)
Calculated Molecular Weight 586 aa, 66 kDa
Observed Molecular Weight65 kDa
GenBank Accession NumberBC039585
Gene Symbol KLHL7
Gene ID (NCBI) 55975
RRIDAB_3742714
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ8IXQ5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KLHL7 (Kelch-like protein 7) is a member of the Kelch-like protein family and plays significant roles in various biological processes, including cell cycle regulation, protein degradation, and cytoskeleton organization. KLHL7 is highly expressed in various cancers and is associated with malignant progression and poor prognosis. In breast cancer, high expression of KLHL7 is linked to higher histological grades, estrogen receptor (ER)-negative or human epidermal growth factor receptor 2 (HER-2)-positive tumors, and triple-negative breast cancer (TNBC), and patients with high KLHL7 expression have shorter survival times. In gastric cancer, silencing KLHL7 gene expression can inhibit the proliferation, migration, and invasion of gastric cancer cells and has shown tumor-suppressive effects in in vivo models. Moreover, KLHL7 is highly expressed in colorectal cancer and ovarian cancer, among others, and is significantly associated with low patient survival rates.

Protocols

Product Specific Protocols
WB protocol for KLHL7 antibody 32697-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...