Use Able AI chat for product recommendations

KLK3/PSA Monoclonal antibody

KLK3/PSA Monoclonal Antibody for WB, IHC, ELISA

Cat No. 60338-1-Ig
Clone No. 4A1E2
Publications (9)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, ELISA

KLK3, 4A1E2, APS, EC:3.4.21.77, Gamma-seminoprotein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for KLK3/PSA in ?

Tested Applications

Positive WB detected inLNCaP cells
Positive IHC detected inhuman prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:5000-1:20000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60338-1-Ig targets KLK3/PSA in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1060

Product name: Recombinant human KLK3,PSA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-261 aa of BC005307

Sequence: MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Predict reactive species
Full Name kallikrein-related peptidase 3
Calculated Molecular Weight 29 kDa
Observed Molecular Weight 30-34 kDa
GenBank Accession NumberBC005307
Gene Symbol KLK3
Gene ID (NCBI) 354
RRIDAB_2881447
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP07288
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KLK3 also known as Prostate-Specific Antigen (PSA), is a 33 kDa glycoprotein primarily synthesized by the epithelial cells of the prostate gland. Its main physiological function is to cleave seminogelins I and II in semen, leading to the liquefaction of the seminal coagulum and the release of motile sperm. It is under tight regulation by androgens via the androgen receptor (AR). Serum PSA levels are elevated in prostate cancer due to disruption of the glandular architecture, allowing more PSA to enter the bloodstream. It is used alongside digital rectal exam (DRE) for early detection. Although termed "prostate-specific," PSA is not exclusively produced by the prostate. Very low levels can be produced in periurethral glands, breast tissue, and some other tissues. Its expression is highly abundant in prostatic tissue and seminal fluid.

Protocols

Product Specific Protocols
IHC protocol for KLK3/PSA antibody 60338-1-IgDownload protocol
WB protocol for KLK3/PSA antibody 60338-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The KLK3/PSA Monoclonal antibody (4A1E2), catalog number 60338-1-Ig, has 9 total citations. These appear in journals including Cancer Research, Cell Death & Disease, Biosensors and Bioelectronics, ACS Applied Materials & Interfaces, Cell Signaling, Journal of Cellular Communication and Signaling, Journal of Natural Medicine, and bioRxiv. The research fields span prostate cancer progression, androgen receptor signaling, ERAD regulation, lipogenesis, biomarker detection, and anticancer therapy strategies.

SpeciesApplicationTitle
humanWB,IHC

Cancer Res

Malonyl-CoA Promotes Prostate Cancer Progression and Castration Resistance by Enhancing Lipogenesis and Ran Activation.

Authors - Yiheng Dai
humanWB

Cell Death Dis

N-glycosylation of GDF15 abolishes its inhibitory effect on EGFR in AR inhibitor-resistant prostate cancer cells

Authors - Rong Wang

Biosens Bioelectron

Self-reporting plasmonic nanoflowers enable magnetically enriched SERS immunoassay for ultrasensitive prostate cancer biomarker detection

Authors - Haoran Zheng
humanWB

ACS Appl Mater Interfaces

Two-in-One Polymeric NO-Donor Prodrugs Mediate Precision and Synergistic Prostate Cancer Treatment

Authors - Bingbing Zhao
humanWB

Cell Signal

1,25(OH)2 D3 induced vitamin D receptor signaling negatively regulates endoplasmic reticulum-associated degradation (ERAD) and androgen receptor signaling in human prostate cancer cells

Authors - Yalcin Erzurumlu
humanWB

Cell Signal

Triiodothyronine positively regulates endoplasmic reticulum-associated degradation (ERAD) and promotes androgenic signaling in androgen-dependent prostate cancer cells

Authors - Yalcin Erzurumlu
Loading...
||
New chat

Able™

正在加载,请稍候...