KLK3/PSA Monoclonal antibody

• 

  WB analysis using 60338-1-Ig

  PC-3(PSA-), DU 145(PSA-) and LNCaP (PSA+) cell lysates were subjected to SDS PAGE followed by western blot with 60338-1-Ig (KLK3/PSA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 60338-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 60338-1-Ig (KLK3/PSA antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 60338-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 60338-1-Ig (KLK3/PSA antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 60338-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using (KLK3,PSA Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human prostate cancer using 60338-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using (KLK3,PSA Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human prostate cancer using 60338-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 60338-1-Ig (KLK3,PSA antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 60338-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 60338-1-Ig (KLK3,PSA antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

KLK3/PSA Monoclonal Antibody for WB, IHC, ELISA

Cat No. 60338-1-Ig

Clone No.4A1E2

Publications(6)

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

KLK3, 4A1E2, APS, EC:3.4.21.77, Gamma-seminoprotein

---

Tested Applications

• Positive WB detected in: LNCaP cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:5000-1:20000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below

Product Information

60338-1-Ig targets KLK3/PSA in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1060

  Product name: Recombinant human KLK3,PSA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-261 aa of BC005307

  Sequence: MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

• Full Name: kallikrein-related peptidase 3
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 30-34 kDa
• GenBank Accession Number: BC005307
• Gene Symbol: KLK3
• Gene ID (NCBI): 354
• RRID: AB_2881447
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P07288
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KLK3 also known as Prostate-Specific Antigen (PSA), is a 33 kDa glycoprotein primarily synthesized by the epithelial cells of the prostate gland. Its main physiological function is to cleave seminogelins I and II in semen, leading to the liquefaction of the seminal coagulum and the release of motile sperm. It is under tight regulation by androgens via the androgen receptor (AR). Serum PSA levels are elevated in prostate cancer due to disruption of the glandular architecture, allowing more PSA to enter the bloodstream. It is used alongside digital rectal exam (DRE) for early detection. Although termed "prostate-specific," PSA is not exclusively produced by the prostate. Very low levels can be produced in periurethral glands, breast tissue, and some other tissues. Its expression is highly abundant in prostatic tissue and seminal fluid.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Death Dis; N-glycosylation of GDF15 abolishes its inhibitory effect on EGFR in AR inhibitor-resistant prostate cancer cells; Authors - Rong Wang
human	WB	J Cell Commun Signal; Estrogens drive the endoplasmic reticulum-associated degradation and promote proto-oncogene c-Myc expression in prostate cancer cells by androgen receptor/estrogen receptor signaling; Authors - Yalcin Erzurumlu
human	WB	Cell Signal; 1,25(OH)2 D3 induced vitamin D receptor signaling negatively regulates endoplasmic reticulum-associated degradation (ERAD) and androgen receptor signaling in human prostate cancer cells; Authors - Yalcin Erzurumlu
human	WB	ACS Appl Mater Interfaces; Two-in-One Polymeric NO-Donor Prodrugs Mediate Precision and Synergistic Prostate Cancer Treatment; Authors - Bingbing Zhao
human	WB	Cell Signal; Triiodothyronine positively regulates endoplasmic reticulum-associated degradation (ERAD) and promotes androgenic signaling in androgen-dependent prostate cancer cells; Authors - Yalcin Erzurumlu
human	WB	J Nat Med; Potent carotenoid astaxanthin expands the anti-cancer activity of cisplatin in human prostate cancer cells; Authors - Yalcin Erzurumlu