KLK3/PSA Monoclonal antibody, PBS Only

KLK3/PSA Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 60338-1-PBS
Clone No.4A1E2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Indirect ELISA

KLK3, 4A1E2, APS, EC:3.4.21.77, Gamma-seminoprotein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60338-1-PBS targets KLK3/PSA in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1060

Product name: Recombinant human KLK3,PSA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-261 aa of BC005307

Sequence: MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Predict reactive species
Full Name kallikrein-related peptidase 3
Calculated Molecular Weight 29 kDa
Observed Molecular Weight 30-34 kDa
GenBank Accession NumberBC005307
Gene Symbol KLK3
Gene ID (NCBI) 354
RRIDAB_2881447
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP07288
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. kallikrein-related peptidase 3, which is also called PSA (prostate-specific antigen) in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. KLK3 has 5 isoforms produced by alternative splicing.

Loading...
||
New chat Able
正在加载,请稍候...