KLK3/PSA Recombinant monoclonal antibody

• 

  WB analysis of LNCaP using 84059-5-RR

  LNCaP cells were subjected to SDS PAGE followed by western blot with 84059-5-RR (KLK3/PSA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 84059-5-RR

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 84059-5-RR (KLK3/PSA antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of LNCaP using 84059-5-RR

  Immunofluorescent analysis of (4% PFA) fixed LNCaP cells using KLK3/PSA antibody (84059-5-RR, Clone: 241263F8 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  FC experiment of HeLa using 84059-5-RR

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug KLK3/PSA Recombinant antibody (84059-5-RR, Clone:241263F8) and PE-conjugated Goat Anti-Rabbit IgG(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set.

• 

  Affinity and Kinetic Characterization of 84059-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84059-5-RR against Human KLK3/PSA were performed. The affinity constant is 149 nM.

KLK3/PSA Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 84059-5-RR

Clone No.241263F8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

KLK3, 241263F8, APS, EC:3.4.21.77, Gamma-seminoprotein

---

Tested Applications

• Positive WB detected in: LNCaP cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: LNCaP cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84059-5-RR targets KLK3/PSA in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0869

  Product name: Recombinant Human KLK3/PSA protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-10*His

  Domain: 18-261 aa of NM_001648.2

  Sequence: APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

• Full Name: kallikrein-related peptidase 3
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 30-34 kDa
• GenBank Accession Number: NM_001648.2
• Gene Symbol: KLK3
• Gene ID (NCBI): 354
• RRID: AB_3671627
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P07288-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KLK3 also known as Prostate-Specific Antigen (PSA), is a 33 kDa glycoprotein primarily synthesized by the epithelial cells of the prostate gland. Its main physiological function is to cleave seminogelins I and II in semen, leading to the liquefaction of the seminal coagulum and the release of motile sperm. It is under tight regulation by androgens via the androgen receptor (AR). Serum PSA levels are elevated in prostate cancer due to disruption of the glandular architecture, allowing more PSA to enter the bloodstream. It is used alongside digital rectal exam (DRE) for early detection. Although termed "prostate-specific," PSA is not exclusively produced by the prostate. Very low levels can be produced in periurethral glands, breast tissue, and some other tissues. Its expression is highly abundant in prostatic tissue and seminal fluid.