KLK4 Polyclonal antibody

• 

  IP experiment of DU 145 using 26547-1-AP

  IP result of anti-KLK4 (IP:26547-1-AP, 4ug; Detection:26547-1-AP 1:300) with DU 145 cells lysate 2200ug.

• 

  IHC staining of human prostate hyperplasia using 26547-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 26547-1-AP (KLK4 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human prostate hyperplasia using 26547-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 26547-1-AP (KLK4 Antibody) at dilution of 1:200 (under 40x lens).

KLK4 Polyclonal Antibody for IP, IHC, ELISA

Cat No. 26547-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

ARM1, EMSP, EMSP1, Kallikrein 4, Kallikrein like protein 1, kallikrein related peptidase 4, KLK L1, KLK4, PROSTASE, PRSS17, PSTS, Serine protease 17

---

Tested Applications

• Positive IP detected in: DU 145 cells
• Positive IHC detected in: human prostate hyperplasia tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

26547-1-AP targets KLK4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24240

  Product name: Recombinant human KLK4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 67-114 aa of BC069325

  Sequence: LSAAHCFQNSYTIGLGLHSLEADQEPGSQMVEASLSVRHPEYNRPLLA

• Full Name: kallikrein-related peptidase 4
• Calculated Molecular Weight: 254 aa, 27 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC069325
• Gene Symbol: KLK4
• Gene ID (NCBI): 9622
• RRID: AB_2880548
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5K2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Am J Pathol; Kallikrein-Related Peptidase 4 Promotes Proliferation, Migration, Invasion, and Pro-Angiogenesis of Endometrial Stromal Cells via Regulation of Brain-Derived Neurotrophic Factor Production in Endometriosis; Authors - Jingwen Shi
mouse	IF	Cell Res; Raptin, a sleep-induced hypothalamic hormone, suppresses appetite and obesity; Authors - Ling-Qi Xie