FITC Plus Anti-Rat KLRB1/CD161 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FITC Plus Anti-Rat KLRB1/CD161 Rabbit Recombinant Antibody (FITC-98249)

KLRB1/CD161 Uni-rAb^® Recombinant Antibody for FC

Cat No. FITC-98249 Copied!

Clone No. 241840F3

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

FC

Synonyms

KLRB1A/CD161a, 241840F3, Antigen 3.2.3, CD161 antigen-like family member A, CD161a

• 

  FC experiment of rat splenocytes using FITC-98249

  1x10^6 rat splenocytes were surface stained with 0.25 ug FITC Plus Anti-Rat KLRB1/CD161 Rabbit RecAb (FITC-98249, Clone: 241840F3) or FITC Plus Rabbit IgG Isotype Control RecAb (FITC-98136, Clone: 240953C9). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of rat splenocytes using FITC-98249

  1x10^6 rat splenocytes were surface stained with 0.25 ug FITC Plus Anti-Rat KLRB1/CD161 Rabbit RecAb (FITC-98249, Clone: 241840F3) (red) or FITC Plus Rabbit IgG Isotype Control RecAb (FITC-98136, Clone: 240953C9) (blue). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for KLRB1/CD161 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: rat splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

FITC-98249 targets KLRB1/CD161 in FC applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1466

  Product name: Recombinant Rat KLRB1A/CD161a protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 64-223 aa of NM_001010964.1

  Sequence: RVLVQKPSVEPCRVLIQENLSKTGSPAKLKCPKDWLSHRDKCFHVSQTSITWKESLADCGGKGATLLLVQDQEELRFLRNLTKRISSSFWIGLSYTLSDENWKWINGSTLNSDVLSITGDTEKDSCASVSQDKVLSESCDSDNIWVCQKELKCECMCNDS

• Full Name: killer cell lectin-like receptor subfamily B, member 1A
• Calculated Molecular Weight: 25 kDa
• GenBank Accession Number: NM_001010964.1
• Gene Symbol: Klrb1a
• Gene ID (NCBI): 362443
• RRID: AB_3749442
• Conjugate: FITC Plus Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 495 nm / 524 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P27471
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD161, also known as KLRB1 or NKR-P1A, is a type II transmembrane C-type lectin-like receptor and is expressed on the cell membrane as disulfide-linked homodimer (PMID: 8077657). It is expressed by the majority of NK cells and subsets of peripheral T cells, including both CD4+ and CD8+ T cells, and is expressed preferentially on adult T cells with a "memory" antigenic phenotype (PMID: 8077657; 22566826). Expression of CD161 correlates with the cytotoxic function of CD16+ NK cells, and ligation of CD161 with its ligand LLT1 inhibits NK cell cytotoxicity and cytokine secretion (PMID: 29686665).