KLRG1 Recombinant monoclonal antibody, PBS Only (Detector)

KLRG1 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 84785-1-PBS
Clone No.242327D10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

CLEC15A, C-type lectin domain family 15 member A, ITIM-containing receptor MAFA-L, Killer cell lectin-like receptor subfamily G member 1, MAFA

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84785-1-PBS targets KLRG1 as part of a matched antibody pair:

MP01549-1: 84785-3-PBS capture and 84785-1-PBS detection (validated in Cytometric bead array)

MP01549-2: 84785-2-PBS capture and 84785-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2036

Product name: Recombinant Human KLRG1 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 60-195 aa of NM_005810.4

Sequence: LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF

Predict reactive species
Full Name killer cell lectin-like receptor subfamily G, member 1
Calculated Molecular Weight22 kDa
GenBank Accession NumberNM_005810.4
Gene Symbol KLRG1
Gene ID (NCBI) 10219
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96E93-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...