Tested Applications
| Positive IHC detected in | human kidney tissue, human prostate cancer tissue, human breast cancer tissue, mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10698-1-AP targets KMO in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1109 Product name: Recombinant human KMO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 107-407 aa of BC005297 Sequence: LSVSRENLNKDLLTAAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMPFEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCVLLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLSMYNYIEKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKR Predict reactive species |
| Full Name | kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) |
| Calculated Molecular Weight | 486 aa, 56 kDa |
| Observed Molecular Weight | 56 kDa |
| GenBank Accession Number | BC005297 |
| Gene Symbol | KMO |
| Gene ID (NCBI) | 8564 |
| RRID | AB_2296744 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15229 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KMO(Kynurenine 3-monooxygenase) is an NADPH-dependent flavin monooxygenase, catalysing the hydroxylation of the L-kynurenine to form L-3-hydroxykynurenine. KMO is a membrane protein located on the outer membrane of mitochondria. Tissue distribution studies have revealed that, in rats, highest enzyme activity is found in kidney and liver, with brain having the least activity in comparison to peripheral organs(PMID: 9237672).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for KMO antibody 10698-1-AP | Download protocol |
| IHC protocol for KMO antibody 10698-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The KMO Polyclonal antibody (Cat# 10698-1-AP) has 41 citations. These appear in journals including Circulation Research, Theranostics, International Journal of Biological Sciences, Journal of the American Society of Nephrology, Journal of Internal Medicine, Brain, Behavior, and Immunity, FASEB Journal, PLoS Genetics, Journal of Virology, and Molecular Oncology, among others. Research fields span the kynurenine/tryptophan metabolic pathway, atherosclerosis, kidney disease, depression and neuropathic pain, cancer (breast, liver, glioblastoma, lymphoma), mitochondrial dynamics, stroke, and infectious/inflammatory diseases.
| Species | Application | Title |
|---|---|---|
Circ Res Activation of NAD(P)H Oxidase by Tryptophan-Derived 3-Hydroxykynurenine Accelerates Endothelial Apoptosis and Dysfunction In Vivo. | ||
Gut Microbes Gut-derived lactic acid enhances tryptophan to 5-hydroxytryptamine in regulation of anxiety via Akkermansia muciniphila | ||
Theranostics Circular RNA SCMH1 suppresses KMO expression to inhibit mitophagy and promote functional recovery following stroke | ||
Int J Biol Sci Inhibition of KMO Ameliorates Myocardial Ischemia Injury via Maintaining Mitochondrial Fusion and Fission Balance | ||
J Hazard Mater Particulate matter-induced metabolic recoding of epigenetics in macrophages drives pathogenesis of chronic obstructive pulmonary disease | ||
J Transl Med Identification and experimental validation of KMO as a critical immune-associated mitochondrial gene in unstable atherosclerotic plaque |
Reviews
What customers say
The single review for this product reports a positive experience, describing it as "works good." The user applied it for Western Blot on Huh6 and Hepg2 cells at a 1:1000 dilution and awarded it a 4-star rating. Overall, the feedback indicates reliable performance for WB applications in these liver cancer cell lines.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Hala (Verified Customer) (03-23-2022) | works good
 |
