Importin Alpha 5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Importin Alpha 5 Polyclonal antibody (18137-1-AP)

• Featured Product
• KD/KO Validated

Importin Alpha 5 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 18137-1-AP Copied!

Publications (34)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

IMA5, KPNA1, Importin subunit alpha 1, Importin subunit alpha-5, Importin subunit alpha-5, N-terminally processed

• 

  WB analysis using 18137-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18137-1-AP (importin α5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 18137-1-AP

  WB result of Importin Alpha 5 antibody (18137-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Importin Alpha 5 transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 18137-1-AP

  IP result of anti-Importin Alpha 5 (IP:18137-1-AP, 4ug; Detection:18137-1-AP 1:1000) with HEK-293 cells lysate 1480ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 18137-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 18137-1-AP (importin α5 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 18137-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 18137-1-AP (importin α5 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 18137-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 18137-1-AP (importin α5 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 18137-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 18137-1-AP (importin α5 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 18137-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 18137-1-AP (importin α5 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 18137-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 18137-1-AP (importin α5 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary using 18137-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 18137-1-AP (importin α5 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary using 18137-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 18137-1-AP (importin α5 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 18137-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using Importin Alpha 5 antibody (18137-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 18137-1-AP

  Immunofluorescent analysis of MCF-7 cells, using KPNA1 antibody 18137-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Importin Alpha 5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human testis tissue, human kidney tissue, human placenta tissue, human ovary tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:5000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18137-1-AP targets Importin Alpha 5 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12751

  Product name: Recombinant human KPNA1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 19-272 aa of BC002374

  Sequence: LNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLA

• Full Name: karyopherin alpha 1 (importin alpha 5)
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC002374
• Gene Symbol: Importin Alpha 5
• Gene ID (NCBI): 3836
• RRID: AB_2133553
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52294
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Importins (alpha and beta) are transport factors that transport proteins into the nucleus. alpha importins function by binding transcription factors at nuclear localization sequences (NLS), and associating with importin beta subunits to translocate through the nuclear pore. Six isoforms of alpha importins have been described in human. Importin alpha 5 is the predominant importin in adult CNS and is essential for differentiation and viability of neural cells.

Publications

What published studies show

Importin Alpha 5 Polyclonal antibody (Cat# 18137-1-AP) has 34 citations published across 25 journals, including Nature Immunology, Nature Cell Biology, Nature Communications, PNAS, Cell Reports, PLoS Pathogens, Journal of Neuroscience, and FEBS Journal. Associated research fields include nuclear transport, cancer biology (glioma, renal cell carcinoma, colorectal cancer), virology (HIV, HBV, RSV), cardiology, neuroscience, immunology, and metabolic regulation.

Automatically generated from the 34 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Nat Immunol; Tumor-derived exosomes antagonize innate antiviral immunity.; Authors - Liang Gao
human	WB	Nat Cell Biol; Class 3 PI3K coactivates the circadian clock to promote rhythmic de novo purine synthesis; Authors - Chantal Alkhoury
human	WB	Nat Commun; METTL3 acetylation impedes cancer metastasis via fine-tuning its nuclear and cytosolic functions; Authors - Yuanpei Li
human	WB	Nat Commun; Nuclear-capture of endosomes depletes nuclear G-actin to promote SRF/MRTF activation and cancer cell invasion.; Authors - Sergi Marco
human	WB	Nat Commun; CDK5-dependent phosphorylation and nuclear translocation of TRIM59 promotes macroH2A1 ubiquitination and tumorigenicity.; Authors - Youzhou Sang
human	WB	Nat Commun; Deep learning prioritizes cancer mutations that alter protein nucleocytoplasmic shuttling to drive tumorigenesis; Authors - Yongqiang Zheng

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

One reviewer (4/5 stars) reported successful use of this antibody for both Western Blot at 1:1000 dilution and Immunofluorescence at 1:100 in permeabilized RPE-1 and MSC cells. The reviewer confirmed specificity through siRNA validation, indicating reliable target knockdown results. Overall, the feedback is positive with no noted issues.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

María (Verified Customer) (02-08-2022)

Works for WB (1:1000) and IF in permeabilized cells (1:100). Validated with siRNA

• Applications: Western Blot, Immunofluorescence
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: RPE-1/MSC