CoraLite® Plus 488-conjugated KPNA2 Monoclonal antibody

• 

  IF Staining of MCF-7 using CL488-66870

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using CoraLite® Plus 488 KPNA2 antibody (CL488-66870, Clone: 2G9C1 ) at dilution of 1:200.

• 

  FC experiment of HEK-293T using CL488-66870

  1X10^6 HEK-293T cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human KPNA2 (CL488-66870, Clone:2G9C1) (red), or 0.4 ug Isotype Control. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

KPNA2 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-66870

Clone No.2G9C1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

Synonyms

Karyopherin subunit alpha-2, IPOA1, IPOA 1, IPO A1, Importin subunit alpha-1

---

Tested Applications

• Positive IF/ICC detected in: MCF-7 cells
• Positive FC (Intra) detected in: HEK-293T cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66870 targets KPNA2 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28386

  Product name: Recombinant human KPNA2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 230-529 aa of BC005978

  Sequence: TWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAENLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF

• Full Name: karyopherin alpha 2 (RAG cohort 1, importin alpha 1)
• Calculated Molecular Weight: 57.8 kDa
• Observed Molecular Weight: 55-58 kDa
• GenBank Accession Number: BC005978
• Gene Symbol: KPNA2
• Gene ID (NCBI): 3838
• RRID: AB_3084281
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P52292
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

KPNA2 (karyopherin α2) is a nuclear import factor involved in the nucleocytoplasmic transport system. It is functionally involved in the tumor progression and is elevated in multiple cancers. KPNA2 expression may be a useful prognostic biomarker to monitor cancer prognosis.