KPNA3 Polyclonal antibody

KPNA3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 28050-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Importin alpha Q2, Importin subunit alpha-4, Karyopherin subunit alpha 3, Karyopherin subunit alpha-3, Qip2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells
Positive IHC detected inmouse brain tissue, human brown disease
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28050-1-AP targets KPNA3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27755

Product name: Recombinant human KPNA3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 322-453 aa of BC017355

Sequence: VLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEII

Predict reactive species
Full Name karyopherin alpha 3 (importin alpha 4)
Calculated Molecular Weight 58 kDa
Observed Molecular Weight57-60 kDa
GenBank Accession NumberBC017355
Gene Symbol KPNA3
Gene ID (NCBI) 3839
RRIDAB_3086026
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO00505
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KPNA3, karyopherin subunit alpha 3, also known as SRP1 or IPOA4. It is expected to be located in cytoplasm and nucleus, the protein is ubiquitous and highly expressed in heart, skeletal muscle. The calculated molecular weight of KPNA3 is 57 kDa. Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin.

Protocols

Product Specific Protocols
IF protocol for KPNA3 antibody 28050-1-APDownload protocol
IHC protocol for KPNA3 antibody 28050-1-APDownload protocol
WB protocol for KPNA3 antibody 28050-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...