KPNA3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KPNA3 Polyclonal antibody, PBS Only (28050-1-PBS)

• 

  WB analysis using 28050-1-AP (same clone as 28050-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28050-1-AP (KPNA3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28050-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 28050-1-AP (same clone as 28050-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28050-1-AP (KPNA3 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28050-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brown disease using 28050-1-AP (same clone as 28050-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brown disease slide using 28050-1-AP (KPNA3 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28050-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 28050-1-AP (same clone as 28050-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using KPNA3 antibody (28050-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CL488-Phalloidin (green). This data was developed using the same antibody clone with 28050-1-PBS in a different storage buffer formulation.

KPNA3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 28050-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Importin alpha Q2, Importin subunit alpha-4, Karyopherin subunit alpha 3, Karyopherin subunit alpha-3, Qip2

---

Product Information

28050-1-PBS targets KPNA3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27755

  Product name: Recombinant human KPNA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 322-453 aa of BC017355

  Sequence: VLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEII

• Full Name: karyopherin alpha 3 (importin alpha 4)
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 57-60 kDa
• GenBank Accession Number: BC017355
• Gene Symbol: KPNA3
• Gene ID (NCBI): 3839
• RRID: AB_3086026
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00505
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KPNA3, karyopherin subunit alpha 3, also known as SRP1 or IPOA4. It is expected to be located in cytoplasm and nucleus, the protein is ubiquitous and highly expressed in heart, skeletal muscle. The calculated molecular weight of KPNA3 is 57 kDa. Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin.