KPNA4 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82898-2-RR (same clone as 82898-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82898-2-RR (KPNA4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82898-2-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 82898-2-RR (same clone as 82898-2-PBS)

  WB result of KPNA4 antibody (82898-2-RR; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-KPNA4 transfected A549 cells. This data was developed using the same antibody clone with 82898-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 82898-2-RR (same clone as 82898-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 82898-2-RR (KPNA4 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82898-2-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 82898-2-RR (same clone as 82898-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using KPNA4 antibody (82898-2-RR, Clone: 230098H1 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 82898-2-PBS in a different storage buffer formulation.

• 

  FC experiment of A549 using 82898-2-RR (same clone as 82898-2-PBS)

  1x10^6 A549 cells were intracellularly stained with 0.25 ug KPNA4 Recombinant antibody (82898-2-RR, Clone:230098H1) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 82898-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82898-2-RR

  Biolayer interferometry (BLl) kinetic assays of 82898-2-RR against Human KPNA4 were performed. The affinity constant is 0.678 nM.

• Featured Product
• KD/KO Validated

KPNA4 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 82898-2-PBS

Clone No.230098H1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

QIP1, KPNA 4, Karyopherin subunit alpha-4, IPOA3, Importin subunit alpha-3

---

Product Information

82898-2-PBS targets KPNA4 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3133

  Product name: Recombinant human KPNA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC034493

  Sequence: MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFL

• Full Name: karyopherin alpha 4 (importin alpha 3)
• Calculated Molecular Weight: 521 aa, 58 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC034493
• Gene Symbol: KPNA4
• Gene ID (NCBI): 3840
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00629
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KPNA4, also named importin subunit alpha-3, karyopherin-alpha4, is a cytoplasmic protein that recognizes nuclear localization signals (NLSs) and dock NLS-containing proteins to the nuclear pore complex. Nuclear import, mediated in part by karyopherin-α (KPNA)/importin-α subtypes, regulates transcription factor access to the genome and determines cell fate. KPNA4-mediated nuclear transport of Ras-responsive element-binding protein (RREB1), which sustains Ras/ERK pathway signaling through repressing miR-143/145 expression (PMID: 31822798). KPNA4 is one of the main isoforms that is activated in many human cancers. KPNA4 expression was elevated in head and neck of squamous cell carcinoma (PMID: 33188837).