• Featured Product
  • KD/KO Validated

KPNA4 Recombinant monoclonal antibody, PBS Only

KPNA4 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 82898-2-PBS
Clone No.230098H1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

QIP1, KPNA 4, Karyopherin subunit alpha-4, IPOA3, Importin subunit alpha-3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82898-2-PBS targets KPNA4 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3133

Product name: Recombinant human KPNA4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC034493

Sequence: MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFL

Predict reactive species
Full Name karyopherin alpha 4 (importin alpha 3)
Calculated Molecular Weight 521 aa, 58 kDa
Observed Molecular Weight 58 kDa
GenBank Accession NumberBC034493
Gene Symbol KPNA4
Gene ID (NCBI) 3840
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00629
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

KPNA4, also named importin subunit alpha-3, karyopherin-alpha4, is a cytoplasmic protein that recognizes nuclear localization signals (NLSs) and dock NLS-containing proteins to the nuclear pore complex. Nuclear import, mediated in part by karyopherin-α (KPNA)/importin-α subtypes, regulates transcription factor access to the genome and determines cell fate. KPNA4-mediated nuclear transport of Ras-responsive element-binding protein (RREB1), which sustains Ras/ERK pathway signaling through repressing miR-143/145 expression (PMID: 31822798). KPNA4 is one of the main isoforms that is activated in many human cancers. KPNA4 expression was elevated in head and neck of squamous cell carcinoma (PMID: 33188837).

Loading...
||
New chat

Able

正在加载,请稍候...