• Featured Product
  • KD/KO Validated

KPNA4 Recombinant monoclonal antibody

KPNA4 Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 82898-2-RR
Clone No.230098H1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

QIP1, KPNA 4, Karyopherin subunit alpha-4, IPOA3, Importin subunit alpha-3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, A549 cells, Jurkat cells, NIH/3T3 cells, mouse ovary tissue, mouse testis tissue, rat testis tissue
Positive IHC detected inhuman intrahepatic cholangiocarcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU2OS cells
Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82898-2-RR targets KPNA4 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3133

Product name: Recombinant human KPNA4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC034493

Sequence: MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFL

Predict reactive species
Full Name karyopherin alpha 4 (importin alpha 3)
Calculated Molecular Weight 521 aa, 58 kDa
Observed Molecular Weight 58 kDa
GenBank Accession NumberBC034493
Gene Symbol KPNA4
Gene ID (NCBI) 3840
RRIDAB_3670627
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00629
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KPNA4, also named importin subunit alpha-3, karyopherin-alpha4, is a cytoplasmic protein that recognizes nuclear localization signals (NLSs) and dock NLS-containing proteins to the nuclear pore complex. Nuclear import, mediated in part by karyopherin-α (KPNA)/importin-α subtypes, regulates transcription factor access to the genome and determines cell fate. KPNA4-mediated nuclear transport of Ras-responsive element-binding protein (RREB1), which sustains Ras/ERK pathway signaling through repressing miR-143/145 expression (PMID: 31822798). KPNA4 is one of the main isoforms that is activated in many human cancers. KPNA4 expression was elevated in head and neck of squamous cell carcinoma (PMID: 33188837).

Protocols

Product Specific Protocols
FC protocol for KPNA4 antibody 82898-2-RRDownload protocol
IF protocol for KPNA4 antibody 82898-2-RRDownload protocol
IHC protocol for KPNA4 antibody 82898-2-RRDownload protocol
WB protocol for KPNA4 antibody 82898-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...