CoraLite® Plus 488-conjugated KPNA4 Recombinant monoclonal antibody

• 

  IF Staining of A549 using CL488-82898

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using CoraLite® Plus 488 KPNA4 antibody (CL488-82898, Clone: 230098H3 ) at dilution of 1:200, CL594-phalloidin (red).

• 

  IF Staining of U2OS using CL488-82898

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using CoraLite® Plus 488 KPNA4 antibody (CL488-82898, Clone: 230098H3 ) at dilution of 1:200, CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

KPNA4 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-82898

Clone No.230098H3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

Importin subunit alpha-3, IPOA3, Karyopherin subunit alpha-4, KPNA 4, QIP1

---

Tested Applications

• Positive IF/ICC detected in: U2OS cells, A549 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82898 targets KPNA4 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3133

  Product name: Recombinant human KPNA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC034493

  Sequence: MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFL

• Full Name: karyopherin alpha 4 (importin alpha 3)
• Calculated Molecular Weight: 521 aa, 58 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC034493
• Gene Symbol: KPNA4
• Gene ID (NCBI): 3840
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00629
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.