KPNA6 Polyclonal antibody

• 

  WB analysis of BxPC-3 using 12366-2-AP

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 12366-2-AP (KPNA6 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12366-2-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12366-2-AP (KPNA6 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 12366-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12366-2-AP (KPNA6 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 12366-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12366-2-AP (KPNA6 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 12366-2-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12366-2-AP (KPNA6 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 12366-2-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12366-2-AP (KPNA6 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 12366-2-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 12366-2-AP (KPNA6 antibody) at dilution of 1:50 (under 10x lens).

KPNA6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12366-2-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Importin subunit alpha 7, IPOA7, Karyopherin subunit alpha 6, KPNA6

---

Tested Applications

• Positive WB detected in: BxPC-3 cells, HeLa cells
• Positive IHC detected in: human breast cancer tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below

Product Information

12366-2-AP targets KPNA6 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3040

  Product name: Recombinant human KPNA6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 185-536 aa of BC020520

  Sequence: EQAVWALGNIAGDSSVCRDYVLNCSILNPLLTLLTKSTRLTMTRNAVWALSNLCRGKNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRLVELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSLGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNPYCGLIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEDDDSSLAPQVDETQQQFIFQQPEAPMEGFQL

• Full Name: karyopherin alpha 6 (importin alpha 7)
• Calculated Molecular Weight: 536 aa, 60 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC020520
• Gene Symbol: KPNA6
• Gene ID (NCBI): 23633
• RRID: AB_2281067
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60684
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Nuclear-capture of endosomes depletes nuclear G-actin to promote SRF/MRTF activation and cancer cell invasion.; Authors - Sergi Marco
human	WB	Virol Sin; African Swine Fever Virus MGF360-12L Inhibits Type I Interferon Production by Blocking the Interaction of Importin α and NF-κB Signaling Pathway.; Authors - Yisha Zhuo
human	WB	Viruses; Ivermectin Inhibits HBV Entry into the Nucleus by Suppressing KPNA2; Authors - Anna Nakanishi
human	WB	Cell Death Dis; Oncometabolite fumarate facilitates PD-L1 expression and immune evasion in clear cell renal cell carcinoma; Authors - Yi Gao