KRCC1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• KRCC1 Polyclonal antibody (16916-1-AP)

• Featured Product
• KD/KO Validated

KRCC1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 16916-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Lysine-rich coiled-coil protein 1, Cryptogenic hepatitis-binding protein 2, CHBP2, BM-044, BM-003

• 

  WB analysis using 16916-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 16916-1-AP (KRCC1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 16916-1-AP

  WB result of KRCC1 antibody (16916-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-KRCC1 transfected MCF-7 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 16916-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using 16916-1-AP (KRCC1 antibody) at dilution of 1:100 and CoraLite488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for KRCC1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16916-1-AP targets KRCC1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10157

  Product name: Recombinant human KRCC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-187 aa of BC107580

  Sequence: MKHSKKTYDSFQDELEDYIKVQKARGLEPKTCFRKMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENRLPQWLPAHDSRLRLDSLSYCQFTRDCFSEKPVPLNFNQQEYICGSHGVEHRVYKHFSSDNSTSTHQASHKQIHQKRKRHPEEGREKSEEERSKHKRKKKLRGN

• Full Name: lysine-rich coiled-coil 1
• Calculated Molecular Weight: 187 aa, 22 kDa
• Observed Molecular Weight: 31-35 kDa
• GenBank Accession Number: BC107580
• Gene Symbol: KRCC1
• Gene ID (NCBI): 51315
• RRID: AB_2878331
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NPI7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The KRCC1 Polyclonal antibody (Cat# 16916-1-AP) has 2 citations. One appeared in Nucleic Acids Research (2022), investigating KRCC1 as a modulator of the DNA damage response. The other was published in FASEB Journal (2019), exploring KRCC1 as a potential therapeutic target in ovarian cancer. Both studies used the antibody for Western blotting on human samples, with one also employing immunofluorescence. The associated research fields are DNA damage response and ovarian cancer biology.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Nucleic Acids Res; KRCC1, a modulator of the DNA damage response; Authors - Fiifi Neizer-Ashun ; KD Validated
human	WB	FASEB J; KRCC1: A potential therapeutic target in ovarian cancer.; Authors - Shailendra Kumar Dhar Dwivedi