KREMEN1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• KREMEN1 Polyclonal antibody (32552-1-AP)

• 

  WB analysis using 32552-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32552-1-AP (KREMEN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

KREMEN1 Polyclonal Antibody for WB, ELISA

Cat No. 32552-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Kringle-containing protein marking the eye and the nose, Kringle domain-containing transmembrane protein 1, Kremen protein 1, KREMEN, KREMEM1

---

Tested Applications

• Positive WB detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32552-1-AP targets KREMEN1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37569

  Product name: Recombinant human KREMEN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 100-370 aa of BC063787

  Sequence: AEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPP

• Full Name: kringle containing transmembrane protein 1
• Calculated Molecular Weight: 473 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC063787
• Gene Symbol: KREMEN1
• Gene ID (NCBI): 83999
• RRID: AB_3742654
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96MU8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Kremen protein 1 (KREMEN1, also known as KRM1) is a transmembrane protein that is a negative regulator of the Wnt signaling pathway (PMID: 26206087; 18502762). KREMEN1 is one of the alternative functional receptors that play essential roles in ACE2-independent virus entry, providing insight into SARS-CoV-2 tropism and pathogenesis, as well as a community resource and potential therapeutic strategies for further COVID-19 investigations (PMID: 34837059; 34903854).