KRR1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86993-3-RR (same clone as 86993-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86993-3-RR (KRR1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86993-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 86993-3-RR (same clone as 86993-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using KRR1 antibody (86993-3-RR, Clone: 252034F1 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86993-3-PBS in a different storage buffer formulation.

• 

  IF Staining of RAW 264.7 using 86993-3-RR (same clone as 86993-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed RAW 264.7 cells using KRR1 antibody (86993-3-RR, Clone: 252034F1 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86993-3-PBS in a different storage buffer formulation.

KRR1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86993-3-PBS

Clone No.252034F1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

HIV-1 Rev-binding protein 2, HRB2, KRR-R motif-containing protein 1, Rev-interacting protein 1, RIP 1

---

Product Information

86993-3-PBS targets KRR1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3464

  Product name: Recombinant human KRR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-381 aa of BC026107

  Sequence: MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVALDTMKNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEADEKKKKKKK

• Full Name: KRR1, small subunit (SSU) processome component, homolog (yeast)
• Calculated Molecular Weight: 381 aa, 44 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC026107
• Gene Symbol: KRR1
• Gene ID (NCBI): 11103
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13601
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KRR1 (also known as RIP-1) is a key assembly factor in the biogenesis of 40S precursor ribosomes (90S). As a rate-limiting node in ribosome biogenesis, its expression level reflects overall ribosome production activity.