Cytokeratin 15 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Cytokeratin 15 Polyclonal antibody (10137-1-AP)

• KD/KO Validated

Cytokeratin 15 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10137-1-AP Copied!

Publications (25)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

KRT15, CK 15, CK15, CK-15, Cytokeratin,Keratin

• 

  WB analysis of A431 using 10137-1-AP

  WB result of Cytokeratin 15 antibody (10137-1-AP; 1:100000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Cytokeratin 15 transfected A431 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 10137-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 10137-1-AP (Cytokeratin 15 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10137-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10137-1-AP (Cytokeratin 15 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 10137-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 10137-1-AP (Cytokeratin 15 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 10137-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 10137-1-AP (Cytokeratin 15 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of A431 using 10137-1-AP

  IP result of anti-Cytokeratin 15 (IP:10137-1-AP, 4ug; Detection:10137-1-AP 1:8000) with A431 cells lysate 1000 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 10137-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 10137-1-AP (Cytokeratin 15 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 10137-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 10137-1-AP (Cytokeratin 15 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human oesophagus cancer using 10137-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 10137-1-AP (Cytokeratin 15 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human oesophagus cancer using 10137-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 10137-1-AP (Cytokeratin 15 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10137-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10137-1-AP (Cytokeratin 15 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10137-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10137-1-AP (Cytokeratin 15 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 10137-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Cytokeratin 15 antibody (10137-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 10137-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using Cytokeratin 15 antibody (10137-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Cytokeratin 15 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, mouse thymus tissue, HeLa cells, PC-3 cells
• Positive IP detected in: A431 cells
• Positive IHC detected in: human cervical cancer tissue, human oesophagus cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10137-1-AP targets Cytokeratin 15 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0185

  Product name: Recombinant human KRT15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 238-450 aa of BC002641

  Sequence: AYLKKNHEEEMKEFSSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDVEAWFFSKTEELNKEVASNTEMIQTSKTEITDLRRTMQELEIELQSQLSMKAGLENSLAETECRYATQLQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVS

• Full Name: keratin 15
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC002641
• Gene Symbol: KRT15
• Gene ID (NCBI): 3866
• RRID: AB_2234359
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P19012
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 15 is a type I cytokeratin. It is found in some progenitor basal cells within complex epithelia.

Publications

What published studies show

The Cytokeratin 15 Polyclonal antibody (Cat# 10137-1-AP) has 25 citations across journals including J Control Release, Mater Today Bio, Genomics Proteomics Bioinformatics, J Invest Dermatol, Stem Cells, iScience, Carcinogenesis, Sci Rep, PLoS One, and Int J Mol Sci. Research fields span corneal epithelial biology, hair follicle stem cells, wound healing, esophageal and skin cancers, androgenetic alopecia, and tissue regeneration, with applications primarily in IF, WB, and IHC across human, mouse, rat, and goat species.

Automatically generated from the 25 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	J Control Release; M2 macrophage-derived exosomes deliver NGF-modified mRNA to promote comprehensive corneal repair.; Authors - Danni Gong
mouse	IF	Mater Today Bio; Matrix-free cryo-microneedles array patch for 3D hair follicle organoids delivery and rapid hair regeneration.; Authors - Shu Wang
human	WB	Genomics Proteomics Bioinformatics; A Single-cell and Spatially Resolved Cell Atlas of Human Esophageal Squamous Cell Carcinoma.; Authors - Yong Shi
human	IF	J Invest Dermatol; GW bodies: cytoplasmic compartments in normal human skin.; Authors - Zee Jennifer M JM
mouse	IF	J Ethnopharmacol; Dahuang-Gancao Decoction Ameliorates Testosterone-Induced Androgenetic Alopecia in Mice; Authors - Huanzhu Qian
mouse	IHC	Biomater Sci; A hybrid hydrogel composed of chitin and β-glucan for the effective management of wound healing and scarring; Authors - Ximeng Kang