Cytokeratin 80 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Cytokeratin 80 Polyclonal antibody (16835-1-AP)

• Featured Product
• KD/KO Validated

Cytokeratin 80 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16835-1-AP Copied!

Publications (22)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

KRT80, CK 80, CK-80, Cytokeratin-80, K80

• 

  WB analysis of NIH/3T3 using 16835-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 16835-1-AP (KRT80 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human skeletal muscle using 16835-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 16835-1-AP (KRT80 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 16835-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 16835-1-AP (KRT80 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 16835-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 16835-1-AP (KRT80 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 16835-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 16835-1-AP (KRT80 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 16835-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 16835-1-AP (KRT80 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skin using 16835-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 16835-1-AP (Cytokeratin 80 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skin using 16835-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 16835-1-AP (Cytokeratin 80 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human bowen disease using 16835-1-AP

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 16835-1-AP (KRT80 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human bowen disease using 16835-1-AP

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 16835-1-AP (KRT80 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 16835-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 16835-1-AP (KRT80 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 16835-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 16835-1-AP (KRT80 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Cytokeratin 80 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, human skeletal muscle tissue
• Positive IHC detected in: human skin cancer tissue, human bowen disease tissue, human colon cancer, human colon cancer tissue, mouse skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3600
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16835-1-AP targets Cytokeratin 80 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10498

  Product name: Recombinant human KRT80 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-422 aa of BC065180

  Sequence: MACRSCVVGFSSLSSCEVTPVGSPRPGTSGWDSCRAPGPGFSSRSLTGCWSAGTISKVTVNPGLLVPLDVKLDPAVQQLKNQEKEEMKALNDKFASLIGKVQALEQRNQLLETRWSFLQGQDSAIFDLGHLYEEYQGRLQEELRKVSQERGQLEANLLQVLEKVEEFRIRYEDEISKRTDMEFTFVQLKKDLDAECLHRTELETKLKSLESFVELMKTIYEQELKDLAAQVKDVSVTVGMDSRCHIDLSGIVEEVKAQYDAVAARSLEEAEAYSRSQLEEQAARSAEYGSSLQSSRSEIADLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTKLAQLEAALQQAKQDMARQLRKYQELMNVKLALDIEIATYRKLVEGEEGRMDSPSATVVSAVQSRCKTAPSLPYPLCSL

• Full Name: keratin 80
• Calculated Molecular Weight: 422 aa, 47 kDa
• Observed Molecular Weight: 47 kDa, 50 kDa
• GenBank Accession Number: BC065180
• Gene Symbol: KRT80
• Gene ID (NCBI): 144501
• RRID: AB_1851273
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6KB66
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KRT80 is a human IF type II epithelial keratin gene involved in the formation of IF heterodimers in various epithelial cells. KRT80 is overexpressed in many neoplasms and plays an essential role in promoting cell proliferation, migration and invasiveness, and is associated with poor prognosis in cancer patients. KRT80 has three isoforms with predicted MW of 50 kDa, 47 kDa, and 54 kDa.

Publications

What published studies show

The Cytokeratin 80 (KRT80) Polyclonal antibody (Cat# 16835-1-AP) has 22 citations. Journals include Nature Genetics, Cell Discovery, Molecular Cell, Cell Death & Disease, Cell Death Discovery, Inflammation and Regeneration, Cancer Biology & Therapy, International Journal of Molecular Sciences, Scientific Reports, Cancers, iScience, European Journal of Cell Biology, BMC Cancer, Cell Cycle, Metabolic Brain Diseases, Molecular Carcinogenesis, Journal of Cancer, IUBMB Life, Discovery Oncology, Experimental and Therapeutic Medicine, and Histology and Histopathology. Research fields span cancer biology (colorectal, gastric, esophageal, lung, ovarian, breast, prostate, glioblastoma, osteosarcoma, HCC), keratin biology, mechanotransduction, and epigenetics, using WB, IF, and IHC.

Automatically generated from the 22 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Nat Genet; The NALCN channel regulates metastasis and nonmalignant cell dissemination; Authors - Eric P Rahrmann
human	IHC	Cell Discov; Single-cell atlas of keratoconus corneas revealed aberrant transcriptional signatures and implicated mechanical stretch as a trigger for keratoconus pathogenesis.; Authors - Shengqian Dou
human	WB	Mol Cell; Direct epitranscriptomic regulation of mammalian translation initiation through N4-acetylcytidine.; Authors - Daniel Arango
human	WB,IF	Cell Death Dis; Keratin 80 promotes migration and invasion of colorectal carcinoma by interacting with PRKDC via activating the AKT pathway.; Authors - Changcan Li
human	WB,IF	Cell Death Discov; OTUB2 regulates KRT80 stability via deubiquitination and promotes tumour proliferation in gastric cancer.; Authors - Siwen Ouyang
mouse	IF	Inflamm Regen; Collagen type I-mediated mechanotransduction controls epithelial cell fate conversion during intestinal inflammation; Authors - Sakurako Kobayashi