Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Biotin-conjugated Cytokeratin 80 Polyclonal antibody

Cytokeratin 80 Polyclonal Antibody for IHC

Cat No. Biotin-16835

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC

KRT80, CK 80, CK-80, Cytokeratin-80, K80

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Biotin
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman oesophagus cancer tissue, human colon cancer, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-16835 targets Cytokeratin 80 in IHC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10498

Product name: Recombinant human KRT80 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-422 aa of BC065180

Sequence: MACRSCVVGFSSLSSCEVTPVGSPRPGTSGWDSCRAPGPGFSSRSLTGCWSAGTISKVTVNPGLLVPLDVKLDPAVQQLKNQEKEEMKALNDKFASLIGKVQALEQRNQLLETRWSFLQGQDSAIFDLGHLYEEYQGRLQEELRKVSQERGQLEANLLQVLEKVEEFRIRYEDEISKRTDMEFTFVQLKKDLDAECLHRTELETKLKSLESFVELMKTIYEQELKDLAAQVKDVSVTVGMDSRCHIDLSGIVEEVKAQYDAVAARSLEEAEAYSRSQLEEQAARSAEYGSSLQSSRSEIADLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTKLAQLEAALQQAKQDMARQLRKYQELMNVKLALDIEIATYRKLVEGEEGRMDSPSATVVSAVQSRCKTAPSLPYPLCSL

Predict reactive species
Full Name keratin 80
Calculated Molecular Weight 422 aa, 47 kDa
Observed Molecular Weight 47 kDa, 50 kDa
GenBank Accession NumberBC065180
Gene Symbol KRT80
Gene ID (NCBI) 144501
RRIDAB_2934330
Conjugate Biotin
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6KB66
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KRT80 is a human IF type II epithelial keratin gene involved in the formation of IF heterodimers in various epithelial cells. KRT80 is overexpressed in many neoplasms and plays an essential role in promoting cell proliferation, migration and invasiveness, and is associated with poor prognosis in cancer patients. KRT80 has three isoforms with predicted MW of 50 kDa, 47 kDa, and 54 kDa.

Protocols

Product Specific Protocols
IHC protocol for Biotin Cytokeratin 80 antibody Biotin-16835Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...