Kir4.1 Monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Kir4.1 Monoclonal antibody, PBS Only (66931-1-PBS)

Kir4.1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66931-1-PBS Copied!

Clone No. 2D6A6

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

KCNJ10, 2D6A6, ATP-dependent inwardly rectifying potassium channel Kir4.1, ATP-sensitive inward rectifier potassium channel 10, BIRK 10

• 

  WB analysis of mouse cerebellum using 66931-1-Ig (same clone as 66931-1-PBS)

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 66931-1-Ig (Kir4.1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66931-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 66931-1-Ig (same clone as 66931-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 66931-1-Ig (Kir4.1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66931-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SH-SY5Y using 66931-1-Ig (same clone as 66931-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 66931-1-Ig (Kir4.1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66931-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Kir4.1 in ?

Chat with Able

---

Product Information

66931-1-PBS targets Kir4.1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16785

  Product name: Recombinant human KCNJ10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 224-426 aa of BC034036

  Sequence: ETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

• Full Name: potassium inwardly-rectifying channel, subfamily J, member 10
• Calculated Molecular Weight: 379 aa, 41 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC034036
• Gene Symbol: Kir4.1
• Gene ID (NCBI): 3766
• RRID: AB_2882257
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P78508
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATP-sensitive inward rectifier potassium channel 10 (KCNJ10, also known as Kir4.1) is an inwardly rectifying K⁺ channel predominantly expressed in glial cells within the central nervous system. In glial cells, Kir4.1 participates in multiple physiological processes, including the maintenance of extracellular K⁺ homeostasis, preservation of astrocyte resting membrane potential, regulation of cell volume, and promotion of glutamate uptake (PMID: 26961251). Kir4.1 can assemble into Kir4.1/Kir5.1 heteromeric channels, which mediate basolateral K⁺ recycling in renal distal tubules. This activity is essential for tubular Na⁺ reabsorption. Pathogenic mutations in Kir4.1 are associated with EAST/SeSAME syndrome, a genetic disorder marked by renal salt wasting (PMID: 24561201; 8995301).