Kir4.1 Monoclonal antibody, PBS Only

• 

  WB analysis of mouse cerebellum using 66931-1-Ig (same clone as 66931-1-PBS)

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 66931-1-Ig (Kir4.1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66931-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 66931-1-Ig (same clone as 66931-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 66931-1-Ig (Kir4.1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66931-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 66931-1-Ig (same clone as 66931-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 66931-1-Ig (Kir4.1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66931-1-PBS in a different storage buffer formulation.

Kir4.1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66931-1-PBS

Clone No.2D6A6

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse

Applications

WB, Indirect ELISA

Synonyms

BIRK 10, KCNJ10, KCNJ13 PEN, KIR1.2, Kir4.1

---

Product Information

66931-1-PBS targets Kir4.1 in WB, Indirect ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16785

  Product name: Recombinant human KCNJ10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 224-426 aa of BC034036

  Sequence: ETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

• Full Name: potassium inwardly-rectifying channel, subfamily J, member 10
• Calculated Molecular Weight: 379 aa, 41 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC034036
• Gene Symbol: Kir4.1
• Gene ID (NCBI): 3766
• RRID: AB_2882257
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P78508
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.