Kir4.1 Monoclonal antibody

• 

  WB analysis of mouse cerebellum using 66931-1-Ig

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 66931-1-Ig (Kir4.1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 66931-1-Ig

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 66931-1-Ig (Kir4.1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 66931-1-Ig

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 66931-1-Ig (Kir4.1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

Kir4.1 Monoclonal Antibody for WB, ELISA

Cat No. 66931-1-Ig

Clone No.2D6A6

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

BIRK 10, KCNJ10, KCNJ13 PEN, KIR1.2, Kir4.1

---

Tested Applications

• Positive WB detected in: mouse cerebellum tissue, mouse brain tissue, SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

66931-1-Ig targets Kir4.1 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16785

  Product name: Recombinant human KCNJ10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 224-426 aa of BC034036

  Sequence: ETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV

• Full Name: potassium inwardly-rectifying channel, subfamily J, member 10
• Calculated Molecular Weight: 379 aa, 41 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC034036
• Gene Symbol: Kir4.1
• Gene ID (NCBI): 3766
• RRID: AB_2882257
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P78508
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	J Ovarian Res; Ovarian tissue transplantation ameliorates osteoporosis and dyslipidaemia in ovariectomised mice; Authors - Encheng Zhou
mouse	WB	Biochim Biophys Acta Mol Basis Dis; Involvement of Kir4.1 in pain insensitivity of the BTBR mouse model of autism spectrum disorder; Authors - Xiang Li