LAMA2 Recombinant monoclonal antibody

• 

  WB analysis of human placenta using 83007-2-RR

  human placenta tissue were subjected to SDS PAGE followed by western blot with 83007-2-RR (LAMA2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 83007-2-RR

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 83007-2-RR (LAMA2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 83007-2-RR

  Rat heart tissue were subjected to SDS PAGE followed by western blot with 83007-2-RR (LAMA2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 83007-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83007-2-RR against Human LAMA2 were performed. The affinity constant is below 1 pM.

LAMA2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83007-2-RR

Clone No.230541D5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

230541D5, Laminin subunit alpha-2, Laminin-12 subunit alpha, Laminin-2 subunit alpha, Laminin-4 subunit alpha

---

Tested Applications

• Positive WB detected in: rat heart tissue, human placenta tissue, mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83007-2-RR targets LAMA2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34494

  Product name: Recombinant human LAMA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2100-2250 aa of NM_000426

  Sequence: IDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIVASRTGRNGTISVRALDG

• Full Name: laminin, alpha 2
• Calculated Molecular Weight: 344 kDa
• Observed Molecular Weight: 344 kDa
• GenBank Accession Number: NM_000426
• Gene Symbol: LAMA2
• Gene ID (NCBI): 3908
• RRID: AB_3670752
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P24043
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The laminin subunit alpha 2 (LAMA2) gene encodes an alpha 2 chain, which constitutes one of the subunits of laminin 2 (merosin) and laminin 4 (s-merosin). Basal laminae are structural components of the extracellular matrix that influence cell proliferation and differentiation,7 and laminin subunit alpha 2 (LAMA2) is the major component of the basal laminae-α subunit of laminin. (PMID: 30728939)