Anti-Human LAMP3 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human LAMP3 Rabbit Recombinant Antibody (98408-3-RR)

LAMP3 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98408-3-RR

Clone No.242748F3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CD208, DC LAMP, DCLAMP, DC-lysosome-associated membrane glycoprotein, LAMP

• 

  FC experiment of human monocyte-derived dendritic using 98408-3-RR

  1x10^6 unstimulated human CD14+ monocytes or human monocyte-derived dendritic cells were surface stained with 0.25 ug Anti-Human LAMP3 Rabbit RecAb (98408-3-RR, Clone: 242748F3) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human monocyte-derived dendritic using 98408-3-RR

  1x10^6 human monocyte-derived dendritic cells were surface stained with 0.25 ug Anti-Human LAMP3/CD208 Rabbit RecAb (98408-3-RR, Clone: 242748F3) (red) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). 1x10^6 unstimulated human CD14+ monocytes were surface stained with 0.25 ug Anti-Human LAMP3/CD208 Rabbit RecAb (98408-3-RR, Clone: 242748F3) and PE-Conjugated Goat Anti-Rabbit IgG(H+L) (black, dashed). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC detected in: human monocyte-derived dendritic cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98408-3-RR targets LAMP3 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3594

  Product name: Recombinant Human LAMP3 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 28-381 aa of NM_014398.4

  Sequence: KAFPETRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDYT

• Full Name: lysosomal-associated membrane protein 3
• Calculated Molecular Weight: 44 kDa
• GenBank Accession Number: NM_014398.4
• Gene Symbol: LAMP3
• Gene ID (NCBI): 27074
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UQV4
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

LAMP3 (lysosome-associated membrane protein 3), also known as DC-LAMP (DC-lysosome-associated membrane glycoprotein), TSC403, or CD208, is a highly glycosylated lysosomal membrane protein that belongs to the LAMP family. LAMP3 is expressed in lung type II pneumocytes, lymphoid organs, and dendritic cells. It might change the lysosome function after the transfer of peptide-MHC class II molecules to the surface of dendritic cells (PMID:9721848).