LANCL2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LANCL2 Polyclonal antibody, PBS Only (33580-1-PBS)

• 

  WB analysis using 33580-1-AP (same clone as 33580-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33580-1-AP (LANCL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33580-1-PBS in a different storage buffer formulation.

LANCL2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33580-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

GPR69B, LanC-like protein 2, TASP, Testis-specific adriamycin sensitivity protein

---

Product Information

33580-1-PBS targets LANCL2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38046

  Product name: Recombinant human LANCL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-323 aa of BC070049

  Sequence: MGETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATPDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHG

• Full Name: LanC lantibiotic synthetase component C-like 2 (bacterial)
• Calculated Molecular Weight: 450 aa, 51 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC070049
• Gene Symbol: LANCL2
• Gene ID (NCBI): 55915
• RRID: AB_3743019
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9NS86
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LanCL2 is a major male germ cell-specific antioxidant gene that is important for testicular homeostasis. Highly expressed in the brain and testis, LanCL2 expression correlates with testicular maturation and brain development. LanCL2 is enriched in spermatocytes and round spermatids of the testis (PMID: 38790639).