Use Able AI chat for product recommendations

LARP2 Recombinant monoclonal antibody, PBS Only (Detector)

LARP2 Uni-rAb® Recombinant Antibody for IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 84898-3-PBS
Clone No.242486E9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

242486E9, La related protein 1B, La related protein 2, La-related protein 1B, La-related protein 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84898-3-PBS targets LARP2 as part of a matched antibody pair:

MP01618-2: 84898-1-PBS capture and 84898-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag11043

Product name: Recombinant human LARP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-201 aa of BC030516

Sequence: MDSRDHGPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHELLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYRYGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSFKRLEDFRVDEADPIE

Predict reactive species
Full Name La ribonucleoprotein domain family, member 2
Calculated Molecular Weight 201 aa, 24 kDa
GenBank Accession NumberBC030516
Gene Symbol LARP2
Gene ID (NCBI) 55132
RRIDAB_3743824
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ659C4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The La-related proteins (LARPs) share a conserved RNA-binding unit composed of a La Motif and an RNA Recognition Motif (RRM), which recognizes diverse RNA substrates. LARP2 has nine isoforms with MW 30-40 kDa, 90-105 kDa. Alternative splicing has been observed at this locus and multiple variants, encoding distinct isoforms, are described. Additional splice variation has been identified but the full-length nature of these transcripts has not been determined. (PMID: 26501340, PMID: 33292040)

Loading...
||
New chat

Able

正在加载,请稍候...