Home
Products
Primary Antibodies
LARP7 Polyclonal antibody, PBS Only (17067-1-PBS)

Filter: AllWBIHCIF/ICC

WB analysis using 17067-1-AP (same clone as 17067-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 17067-1-AP (LARP7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17067-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 17067-1-AP (same clone as 17067-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17067-1-AP (LARP7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17067-1-PBS in a different storage buffer formulation.
IHC staining of human stomach cancer using 17067-1-AP (same clone as 17067-1-PBS)
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 17067-1-AP (LARP7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17067-1-PBS in a different storage buffer formulation.
IHC staining of human stomach cancer using 17067-1-AP (same clone as 17067-1-PBS)
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 17067-1-AP (LARP7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17067-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 17067-1-AP (same clone as 17067-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta using 17067-1-AP (LARP7 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17067-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 17067-1-AP (same clone as 17067-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta using 17067-1-AP (LARP7 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17067-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 17067-1-AP (same clone as 17067-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis using 17067-1-AP (LARP7 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17067-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 17067-1-AP (same clone as 17067-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis using 17067-1-AP (LARP7 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17067-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 17067-1-AP (same clone as 17067-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin using 17067-1-AP (LARP7 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17067-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 17067-1-AP (same clone as 17067-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin using 17067-1-AP (LARP7 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17067-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 17067-1-AP (same clone as 17067-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver using 17067-1-AP (LARP7 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17067-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 17067-1-AP (same clone as 17067-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver using 17067-1-AP (LARP7 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17067-1-PBS in a different storage buffer formulation.
IHC staining of human spleen using 17067-1-AP (same clone as 17067-1-PBS)
Immunohistochemical analysis of paraffin-embedded human spleen using 17067-1-AP (LARP7 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17067-1-PBS in a different storage buffer formulation.
IHC staining of human spleen using 17067-1-AP (same clone as 17067-1-PBS)
Immunohistochemical analysis of paraffin-embedded human spleen using 17067-1-AP (LARP7 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17067-1-PBS in a different storage buffer formulation.
IHC staining of human ovary using 17067-1-AP (same clone as 17067-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary using 17067-1-AP (LARP7 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17067-1-PBS in a different storage buffer formulation.
IHC staining of human ovary using 17067-1-AP (same clone as 17067-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary using 17067-1-AP (LARP7 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17067-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 17067-1-AP (same clone as 17067-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17067-1-AP (LARP7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17067-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 17067-1-AP (same clone as 17067-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using LARP7 antibody (17067-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 17067-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

LARP7 Polyclonal antibody, PBS Only

Name: LARP7 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 17067-1-PBS

LARP7 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 17067-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

HDCMA18P, hLARP7, La related protein 7, La-related protein 7, PIP7S

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

17067-1-PBS targets LARP7 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag10891 Product name: Recombinant human LARP7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 83-331 aa of BC006981 Sequence: LTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVKNKPIPALRVVEEKKKKKKKKGRMKKEDNIQAKEENMDTSNTSISKMKRSRPTSEGSDIESTEPQKQCSKKKKKRDRVEASSLPEVRTGKRKRSSSEDAESLAPRSKVKKIIQKDIIKEASEASKE Predict reactive species
Full Name	La ribonucleoprotein domain family, member 7
Calculated Molecular Weight	582 aa, 67 kDa
Observed Molecular Weight	67 kDa
GenBank Accession Number	BC006981
Gene Symbol	LARP7
Gene ID (NCBI)	51574
RRID	AB_2132693
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q4G0J3
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

LARP7 belongs to the LARP RNA-binding protein family, which includes the lupus LA antigen gene, and modulates the metabolism and function of a variety of RNA species [PMID:20138158]. LARP7 binds to the 7SK RNP complex, and sequesters the positive transcription elongation factor b (P-TEFb) in an inactive form, preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation. binds to and stabilizes 7sk snRNA[PMID:19416841].