Tested Applications
| Positive WB detected in | A431 cells, MDA-MB-453s cells, mouse brain tissue, PC-3 cells, MCF-7 cells, Jurkat cells, SGC-7901 cells, SKOV-3 cells |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human colon cancer tissue, human breast cancer tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:800-1:3200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10515-1-AP targets LASP1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0800 Product name: Recombinant human LASP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 125-210 aa of BC012460 Sequence: EFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAA Predict reactive species |
| Full Name | LIM and SH3 protein 1 |
| Calculated Molecular Weight | 30 kDa |
| Observed Molecular Weight | 38-40 kDa |
| GenBank Accession Number | BC012460 |
| Gene Symbol | LASP1 |
| Gene ID (NCBI) | 3927 |
| ENSEMBL Gene ID | ENSG00000002834 |
| RRID | AB_2280966 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14847 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LASP1(LIM and SH3 protein 1), also known as MLN50, is a 261 amino acid protein that localizes to both the cytoplasm and the cytoskeleton(PMID: 7589475). LASP1 consists of an N-terminal LIM-domain with two zinc finger motifs, followed by two central actin-binding nebulin repeats, flanked by a linker region and a C-terminal SH3 domain (PMID: 17177073, 9848085). LASP-1 interacts with F-Actin and plays an important role in the regulation of Actin-associated cytoskeletal organization. Agonist-dependent changes in LASP1 phosphorylation may regulate Actin-related ion transport activities in epithelial cells (PMID: 15465019,12571245). Overexpression of LASP-1 is associated with breast cancer, and plays a role in tumor transformation and metastasis (PMID: 17956604).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LASP1 antibody 10515-1-AP | Download protocol |
| IHC protocol for LASP1 antibody 10515-1-AP | Download protocol |
| IP protocol for LASP1 antibody 10515-1-AP | Download protocol |
| WB protocol for LASP1 antibody 10515-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
LASP1 antibody (Cat# 10515-1-AP) has 34 citations across journals including Cell Host Microbe, J Exp Clin Cancer Res, Cell Death Dis, Cancer Lett, Oncogene, Oncotarget, and Mol Biol Cell. Research fields span oncology (colorectal, gastric, hepatocellular, esophageal, and other cancers), neurology (Parkinson's disease, depression, axon development), immunology (NETs, pancreatitis), cardiovascular disease (atherosclerosis, aneurysm), microbiology (Salmonella infection), and reproductive biology.
| Species | Application | Title |
|---|---|---|
Cell Host Microbe Global mapping of Salmonella enterica-host protein-protein interactions during infection. | ||
J Exp Clin Cancer Res Long noncoding RNA AFAP1-AS1 acts as a competing endogenous RNA of miR-423-5p to facilitate nasopharyngeal carcinoma metastasis through regulating the Rho/Rac pathway. | ||
J Exp Clin Cancer Res RNA-binding protein CCDC137 activates AKT signaling and promotes hepatocellular carcinoma through a novel non-canonical role of DGCR8 in mRNA localization | ||
J Exp Clin Cancer Res HSP90-dependent PUS7 overexpression facilitates the metastasis of colorectal cancer cells by regulating LASP1 abundance.
| ||
J Exp Clin Cancer Res ANLN-induced EZH2 upregulation promotes pancreatic cancer progression by mediating miR-218-5p/LASP1 signaling axis. | ||
Cell Death Dis NAT10 promotes the progression of clear cell renal cell carcinoma by regulating ac4C acetylation of NFE2L3 and activating AKT/GSK3β signaling pathway |
Reviews
What customers say
The single review for 10515-1-AP is a 5-star rating from Joleen Cheah (2019). She used the antibody at 1:1k dilution for Western Blot on MDCK GII cells and reported that it works well, staining both endogenous and exogenous LASP1. The accompanying image shows lanes with molecular weight markers, cells expressing GFP-LASP1, and wildtype cells, confirming clear detection of the target protein.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Joleen (Verified Customer) (06-03-2019) | Lanes show molecular weight, then cells expressing GFP-LASP1, then wildtype cells. This antibody works well, staining both endogenous and exogenous LASP1.
 |
