LAYN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LAYN Polyclonal antibody, PBS Only (20535-1-PBS)

• 

  WB analysis using 20535-1-AP (same clone as 20535-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20535-1-AP (LAYN antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20535-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 20535-1-AP (same clone as 20535-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20535-1-AP (LAYN antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20535-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 20535-1-AP (same clone as 20535-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 20535-1-AP (LAYN antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20535-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 20535-1-AP (same clone as 20535-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 20535-1-AP (LAYN antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20535-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 20535-1-AP (same clone as 20535-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 20535-1-AP (LAYN antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20535-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 20535-1-AP (same clone as 20535-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 20535-1-AP (LAYN antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20535-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 20535-1-AP (same clone as 20535-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using LAYN antibody 20535-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 20535-1-PBS in a different storage buffer formulation.

LAYN Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 20535-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

20535-1-PBS targets LAYN in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14508

  Product name: Recombinant human LAYN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 246-374 aa of BC025407

  Sequence: CWVWICRKRKREQPDPSTKKQHTIWPSPHQGNSPDLEVYNVIRKQSEADLAETRPDLKNISFRVCSGEATPDDMSCDYDNMAVNPSESGFMTLVSVESGFVTNDIYEFSPDQMGRSKESGWVENEIYGY

• Full Name: layilin
• Calculated Molecular Weight: 382 aa, 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC025407
• Gene Symbol: LAYN
• Gene ID (NCBI): 143903
• RRID: AB_10696315
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UX15
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.