Home
Products
Primary Antibodies
LCE1B Polyclonal antibody, PBS Only (21771-1-PBS)

Filter: AllWBIHCIF/ICC

WB analysis of A375 using 21771-1-AP (same clone as 21771-1-PBS)
A375 cells were subjected to SDS PAGE followed by western blot with 21771-1-AP (LCE1B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21771-1-PBS in a different storage buffer formulation.
WB analysis of mouse skin using 21771-1-AP (same clone as 21771-1-PBS)
mouse skin tissue were subjected to SDS PAGE followed by western blot with 21771-1-AP (LCE1B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21771-1-PBS in a different storage buffer formulation.
WB analysis of rat skin using 21771-1-AP (same clone as 21771-1-PBS)
rat skin tissue were subjected to SDS PAGE followed by western blot with 21771-1-AP (LCE1B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21771-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 21771-1-AP (same clone as 21771-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin using 21771-1-AP (LCE1B antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21771-1-PBS in a different storage buffer formulation.
IHC staining of human skin using 21771-1-AP (same clone as 21771-1-PBS)
Immunohistochemical analysis of paraffin-embedded human skin using 21771-1-AP (LCE1B antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21771-1-PBS in a different storage buffer formulation.
IHC staining of human oesophagus using 21771-1-AP (same clone as 21771-1-PBS)
Immunohistochemical analysis of paraffin-embedded human oesophagus using 21771-1-AP (LCE1B antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21771-1-PBS in a different storage buffer formulation.
IHC staining of human oesophagus using 21771-1-AP (same clone as 21771-1-PBS)
Immunohistochemical analysis of paraffin-embedded human oesophagus using 21771-1-AP (LCE1B antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21771-1-PBS in a different storage buffer formulation.
IF Staining of A375 using 21771-1-AP (same clone as 21771-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed A375 cells using LCE1B antibody (21771-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 21771-1-PBS in a different storage buffer formulation.

LCE1B Polyclonal antibody, PBS Only

Name: LCE1B Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 21771-1-PBS

LCE1B Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 21771-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

LEP2, SPRL2A, Small proline-rich-like epidermal differentiation complex protein 2A, Late envelope protein 2, late cornified envelope 1B

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

21771-1-PBS targets LCE1B in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag16442 Product name: Recombinant human LCE1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC104232 Sequence: MSCQQNQQQCQPPPKCIPKCPPKCLTPRCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSCGSSSGGCCSSGGGGCCLSHHRRRRSHCHRPQSSGCCSQPSGGSSCCGGGSGQHSGGCC Predict reactive species
Full Name	late cornified envelope 1B
Calculated Molecular Weight	118 aa, 12 kDa
Observed Molecular Weight	10-12 kDa
GenBank Accession Number	BC104232
Gene Symbol	LCE1B
Gene ID (NCBI)	353132
RRID	AB_10858482
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q5T7P3
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Human LCE1B (Late cornified envelope protein 1B), also named late envelope protein 2 (LEP2), is located at human Chromosome1q21 which contains multiple LCE clusters. LCE1B gene is predicated to encode a 118-aa protein, and is currently evidenced at transcript level. Its expression was skin-specific and was readily detected in adult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue (PMID: 15854049). LCE genes respond to environmental stimuli such as calcium levels and ultraviolet (UV) light, however, LCE groups have distinct functions (PMID: 15854049).