LCN1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LCN1 Polyclonal antibody, PBS Only (17900-1-PBS)

• 

  WB analysis of human saliva using 17900-1-AP (same clone as 17900-1-PBS)

  human saliva were subjected to SDS PAGE followed by western blot with 17900-1-AP (LCN1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17900-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Transfected HEK-293 using 17900-1-AP (same clone as 17900-1-PBS)

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 17900-1-AP (LCN1 Antibody) at dilution of 1:1000 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 17900-1-PBS in a different storage buffer formulation.

LCN1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 17900-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

17900-1-PBS targets LCN1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12270

  Product name: Recombinant human LCN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-176 aa of BC074925

  Sequence: MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD

• Full Name: lipocalin 1 (tear prealbumin)
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 17-19 kDa
• GenBank Accession Number: BC074925
• Gene Symbol: LCN1
• Gene ID (NCBI): 3933
• RRID: AB_2878462
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P31025
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.