LDHAL6A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LDHAL6A Polyclonal antibody, PBS Only (16221-1-PBS)

• 

  WB analysis of mouse liver using 16221-1-AP (same clone as 16221-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16221-1-AP (LDHAL6A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16221-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 16221-1-AP (same clone as 16221-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16221-1-AP (LDHAL6A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16221-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 16221-1-AP (same clone as 16221-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 16221-1-AP (LDHAL6A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16221-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 16221-1-AP (same clone as 16221-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 16221-1-AP (LDHAL6A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16221-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 16221-1-AP (same clone as 16221-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 16221-1-AP (LDHAL6A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16221-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 16221-1-AP (same clone as 16221-1-PBS)

  Immunofluorescent analysis of Hela cells, using LDHAL6A antibody 16221-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 16221-1-PBS in a different storage buffer formulation.

LDHAL6A Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 16221-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

16221-1-PBS targets LDHAL6A in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9273

  Product name: Recombinant human LDHAL6A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-234 aa of BC014340

  Sequence: MATIKSELIKNFAEEEAIHHNKISIVGTGSVGVACAISILLKGLSDELVLVDVDEGKLKGETMDLQHGSPFMKMPNIVSSKDYLVTANSNLVIITAGARQKKGETRLDLVQRNVSIFKLMIPNITQYSPHCKLLIVTNPVDILTYVAWKLSGFPKNRVIGSGCNLDSARFRYFIGQRLGIHSESCHGLILGEHGDSSVPVWSGVNIAGVPLKDLNPDIGTDKDPEQWENVHKKK

• Full Name: lactate dehydrogenase A-like 6A
• Calculated Molecular Weight: 26 kDa, 37 kDa
• Observed Molecular Weight: 30-36 kDa
• GenBank Accession Number: BC014340
• Gene Symbol: LDHAL6A
• Gene ID (NCBI): 160287
• RRID: AB_2265629
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZMR3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.