LEFTY1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83586-1-RR (same clone as 83586-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83586-1-RR (LEFTY1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83586-1-PBS in a different storage buffer formulation.

LEFTY1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83586-1-PBS

Clone No.240346E11

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

LEFTB, LEFTY1, LEFTYB, Protein lefty 1, Protein lefty B

---

Product Information

83586-1-PBS targets LEFTY1 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4925

  Product name: Recombinant human LEFTY1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-366 aa of BC027883

  Sequence: EQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQYVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP

• Full Name: left-right determination factor 1
• Calculated Molecular Weight: 366 aa, 41 kDa
• GenBank Accession Number: BC027883
• Gene Symbol: LEFTY1
• Gene ID (NCBI): 10637
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O75610
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.