LEFTY1 Recombinant monoclonal antibody

• 

  WB analysis using 83586-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83586-1-RR (LEFTY1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

LEFTY1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83586-1-RR

Clone No.240346E11

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, ELISA

Synonyms

LEFTB, LEFTY1, LEFTYB, Protein lefty 1, Protein lefty B

---

Tested Applications

• Positive WB detected in: rat heart tissue, mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83586-1-RR targets LEFTY1 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4925

  Product name: Recombinant human LEFTY1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-366 aa of BC027883

  Sequence: EQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQYVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP

• Full Name: left-right determination factor 1
• Calculated Molecular Weight: 366 aa, 41 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: BC027883
• Gene Symbol: LEFTY1
• Gene ID (NCBI): 10637
• RRID: AB_3671200
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O75610
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lefty is a member of the transforming growth factor (TGF) β superfamily, which is implicated in left-right patterning during embryogenesis. The Lefty family is comprised of Lefty 1 and Lefty 2 in mouse, and Lefty A and Lefty B in humans.