LEFTY2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LEFTY2 Polyclonal antibody (13991-1-AP)

LEFTY2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13991-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Endometrial bleeding-associated factor, left right determination factor 2, Left-right determination factor 2, Left-right determination factor A, LEFTY 2

• 

  WB analysis of HeLa using 13991-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13991-1-AP (LEFTY2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse uterus using 13991-1-AP

  mouse uterus tissue were subjected to SDS PAGE followed by western blot with 13991-1-AP (LEFTY2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human endometrial cancer using 13991-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 13991-1-AP (LEFTY2 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human endometrial cancer using 13991-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 13991-1-AP (LEFTY2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 13991-1-AP

  Immunofluorescent analysis of HeLa cells using 13991-1-AP (LEFTY2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LEFTY2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse uterus tissue
• Positive IHC detected in: human endometrial cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13991-1-AP targets LEFTY2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5073

  Product name: Recombinant human LEFTY2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 24-366 aa of BC035718

  Sequence: EEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLLRRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP

• Full Name: left-right determination factor 2
• Calculated Molecular Weight: 366 aa, 41 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC035718
• Gene Symbol: LEFTY2
• Gene ID (NCBI): 7044
• RRID: AB_2135782
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00292
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The LEFTY2 polyclonal antibody (Cat# 13991-1-AP) has 4 citations published in Stroke, Journal of Biological Chemistry, Developmental Biology, and Biochemical Genetics. The associated research fields include brain arteriovenous malformation and endothelial mesenchymal transition, embryonic stem cell mesendoderm differentiation, placental development in diabetic models, and glioblastoma tumor microenvironment analysis involving coagulation-related genes.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Stroke; Mesenchymal Behavior of the Endothelium Promoted by SMAD6 Downregulation Is Associated With Brain Arteriovenous Malformation Microhemorrhage.; Authors - Weilun Fu
mouse	WB	J Biol Chem; MicroRNA-127 Promotes Mesendoderm Differentiation of Mouse Embryonic Stem Cells by Targeting Left-Right Determination Factor 2.; Authors - Haixia Ma
rat	IHC	Dev Biol; Role of EBAF/Nodal/p27 signaling pathway in development of placenta in normal and diabetic rats.; Authors - Qianqian Gao
human	IHC	Biochem Genet; The Role of Coagulation-Related Genes in Glioblastoma: A Comprehensive Analysis of the Tumor Microenvironment, Prognosis, and Treatment; Authors - Jingyi Yang