Leptin Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of 3T3-L1 using 84072-5-RR (same clone as 84072-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed 3T3-L1 cells using LEP antibody (84072-5-RR, Clone: 240720A6 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84072-5-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 84072-5-RR (same clone as 84072-5-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug LEP Recombinant antibody (84072-5-RR, Clone:240720A6) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 84072-5-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 84072-5-RR (same clone as 84072-5-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug LEP Recombinant antibody (84072-5-RR, Clone:240720A6) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 84072-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84072-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84072-5-RR against Human LEP were performed. The affinity constant is 35.3 nM.

Leptin Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), Indirect ELISA

Cat No. 84072-5-PBS

Clone No.240720A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Indirect ELISA

Synonyms

LEP, 240720A6, OB, Obese protein, Obesity factor

---

Product Information

84072-5-PBS targets Leptin in IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0834

  Product name: Recombinant Human Leptin protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: N-6*His

  Domain: 22-167 aa of BC060830

  Sequence: VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

• Full Name: leptin
• Calculated Molecular Weight: 167 aa, 19 kDa
• GenBank Accession Number: BC060830
• Gene Symbol: Leptin
• Gene ID (NCBI): 3952
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P41159
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Leptin is a product of the obese (ob) gene and, following synthesis and secretion from fat cells in white adipose tissue, binds to and activates its cognate receptor, the leptin receptor (LEP-R) (PMID: 34084149). Still, smaller quantities have been detected in other body tissues, including the brown adipose tissue (BAT), placenta, fetal tissue, stomach, muscles, bone marrow, teeth, and brain (PMID:7568067, PMID: 12086939). Leptin circulates in the blood in both free and protein-bound forms, where the free form of leptin is the biologically active form (PMID: 12086939). Leptin can enter the central nervous system (CNS) (in the area of the choroid plexus) by receptor-mediated transport (PMID: 29254602). Leptin secretion is higher in subcutaneous than in visceral adipose tissue (PMID: 11133069, PMID: 14726444).