LEPROT Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LEPROT Polyclonal antibody, PBS Only (20304-1-PBS)

• 

  WB analysis using 20304-1-AP (same clone as 20304-1-PBS)

  pig heart tissue was subjected to SDS PAGE followed by western blot with 20304-1-AP (LEPROT antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20304-1-PBS in a different storage buffer formulation.

LEPROT Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20304-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, pig

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

20304-1-PBS targets LEPROT in WB, Indirect ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14126

  Product name: Recombinant human LEPROT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 12-74 aa of BC011027

  Sequence: GLTFLMLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRVTYDSDATSSACRELAYFFTTGIVV

• Full Name: leptin receptor overlapping transcript
• Calculated Molecular Weight: 131 aa, 14 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC011027
• Gene Symbol: LEPROT
• Gene ID (NCBI): 54741
• RRID: AB_2878667
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15243
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.