LETM2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LETM2 Polyclonal antibody, PBS Only (17180-1-PBS)

• 

  IHC staining of human placenta using 17180-1-AP (same clone as 17180-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 17180-1-AP (LETM2 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17180-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 17180-1-AP (same clone as 17180-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 17180-1-AP (LETM2 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17180-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 17180-1-AP (same clone as 17180-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 17180-1-AP (LETM2 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17180-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 17180-1-AP (same clone as 17180-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 17180-1-AP (LETM2 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17180-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

LETM2 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 17180-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

LETM1 and EF-hand domain-containing protein 2, LETM1 domain-containing protein LETM2, mitochondrial, Leucine zipper-EF-hand-containing transmembrane protein 1-like

---

Product Information

17180-1-PBS targets LETM2 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10900

  Product name: Recombinant human LETM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-277 aa of BC029541

  Sequence: MEEKQKKKMAVKLELAKFLQETMTEMARRNRAKMGDASTQLSSYVKQVQTGHKPSTKEIVRFSKLFEDQLALEHLDRPQLVALCKLLELQTFGTNNLLRFQLLMKLKSIKADDEIIAKEGVTALSVSELQAACRARGMRSLGLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFYLIDVKPKPIEIPLSGEAPKTDILVELPTFTESKENMVDLAPQLKGTKDEDFIQPPPVTSSPITPSTPISLPKGPITSSEEPTLQAKSQMTAQNSKASSKGA

• Full Name: leucine zipper-EF-hand containing transmembrane protein 2
• Calculated Molecular Weight: 277 aa, 31 kDa
• GenBank Accession Number: BC029541
• Gene Symbol: LETM2
• Gene ID (NCBI): 137994
• RRID: AB_2571737
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q2VYF4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.