LGI3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LGI3 Polyclonal antibody, PBS Only (21919-1-PBS)

• 

  WB analysis of HepG2 using 21919-1-AP (same clone as 21919-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 21919-1-AP (LGI3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21919-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21919-1-AP (same clone as 21919-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21919-1-AP (LGI3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21919-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 21919-1-AP (same clone as 21919-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 21919-1-AP (LGI3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21919-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 21919-1-AP (same clone as 21919-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 21919-1-AP (LGI3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21919-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 21919-1-AP (same clone as 21919-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 21919-1-AP (LGI3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21919-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 21919-1-AP (same clone as 21919-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 21919-1-AP (LGI3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21919-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 21919-1-AP (same clone as 21919-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 21919-1-AP (LGI3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21919-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 21919-1-AP (same clone as 21919-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 21919-1-AP (LGI3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21919-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 21919-1-AP (same clone as 21919-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 21919-1-AP (LGI3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21919-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 21919-1-AP (same clone as 21919-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 21919-1-AP (LGI3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21919-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 21919-1-AP (same clone as 21919-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 21919-1-AP (LGI3 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21919-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 21919-1-AP (same clone as 21919-1-PBS)

  Immunofluorescent analysis of HepG2 cells using 21919-1-AP (LGI3 Antibody) at dilution of 1:50 and Rhodamine-labeled goat anti-Rabbit IgG (red). This data was developed using the same antibody clone with 21919-1-PBS in a different storage buffer formulation.

LGI3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 21919-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

21919-1-PBS targets LGI3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16257

  Product name: Recombinant human LGI3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 343-524 aa of BC142997

  Sequence: HQALHPWHRDTDLEFVDGEGKPRLIVSSSSQAPVIYQWSRTQKQFVAQGEVTQVPDAQAVKHFRAGRDSYLCLSRYIGDSKILRWEGTRFSEVQALPSRGSLALQPFLVGGRRYLALGSDFSFTQIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYRHIVVDLSA

• Full Name: leucine-rich repeat LGI family, member 3
• Calculated Molecular Weight: 548 aa, 62 kDa
• Observed Molecular Weight: 55-62 kDa
• GenBank Accession Number: BC142997
• Gene Symbol: LGI3
• Gene ID (NCBI): 203190
• RRID: AB_10838807
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N145
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.